Identifiers and Description

Gene Model Identifier

TTHERM_00523000

Standard Name

None

Aliases

PreTt12415 | 65.m00233 | 3717.m00112

Description

Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00523000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12802.19.997093137033517e-262protein kinase domain-containi
ng protein (617 aa)
OxytrichaContig11760.0.0.g747.00270765106311e-74Protein kinase domain
WormBaseWBGene000005531.9992362000979228e-56locus:cmk-1 Calcium/calmodul
in-dependent protein kinase ty
pe 1 status:Confirmed UniP
rot:Q9TXJ0 protein_id:CCD718
65.1
DictyBaseDDB_G02715501.0001801308941382e-55DDB_G0271550 on chromosome: 2
position 634463 to 636022
SGDYOL016C7.997739975804982e-43CMK2 Calmodulin-dependent prot
ein kinase; may play a role in
stress response, many CA++/ca
lmodulan dependent phosphoryla
tion substrates demonstrated i
n vitro, amino acid sequence s
imilar to Cmk1p and mammalian
Cam Kinase II
Stentor CoeruleusSteCoe_41111.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00523000(coding)
ATGAAGCCTGCATCATTTTTTGACGACGATTATGGAAAATTACAAAAGAAAATCTGGGAT
CCAGTACCCGGCAATAAGACTGTTAGCAACCTTGAAACTGTTTATTTATGCAATCAATTT
TATAAGAGATCAAAGAAAGTAGGTAAATCTAAGCAAATCTACTACGTTCTCACTGAAGAA
GGACTCTATTAAGTTAAAAAAAATGAAGTACTTTGTGGTTTTATGGATTTAACTTGCGTT
AAGATGGACCTCTTGATAGAGGTTTAGGATGCTAAAACTATAGACACAAGCTTGGACAGT
AATCCTAATAATGTTCATGGATTCCGTCTTTCCCGTAACGGCAAATCAATTGAATTCTAC
ACAAATGATAACTTACTCTACAAGAATTGGAAAAATGTCCTTATCTATCGTTGTATTTAA
AGTACTTTTCATGAAGAGTTTATTGTAACCAAGATGATTGGTAAAGGTTCTTTTGCTAAA
GTCTATCTTGCAACAAAGAAGTCATAAAATATCTAATATGCAATTAAAGCCTTCAATAAA
GAATTCATGCAAAATTAGCACAAAGGTAAAGAGTCCTTAATAAATGAAATTTCGATTATG
CGTTAATTGAACAATGATCATTTAATCCGTCTTTATGAAGTATACGAAACCACTAACTCC
ATTTACTTTGTTGTTGATCTCTTGAATGGTGGTGAATTACTTCATCGTATTCGTGAAAAA
GGATCTATAAATGAAAAGGAGCTCCGTGTCCTAATACGTAATCTTATTTTAGCCTTAGAG
CATCTCCATTAGAAGAATATCATGCATAGAGATTTAAAGCCAGAAAATCTCCTTTTAAAG
TCAAAATAATCTGATTCTGAAATTGTCGTTGCTGATTTTGGTCTTGCTACTCGTATAGAT
ATTCCTAATATTTTGTTTAAACGTTGCGGTACTCCTGGTTTTGTAGCTCCTGAAGTTCTC
CTTTACAAGGAAGGTGATCCTTTTTACACTACTTAGTGCGATATTTTCTCTGCTGGTATA
ATATTCTATCTCTTATTAGTAGGAAAGTAGCCATTCTAAGGAAAGGACTATAAGTAGATT
CTAAGAGCAAATAAGGCTTGCGAAATTAGATATGATTTACCAGAGTTTGAAAAAATTTCT
AATGCTGCCAAAGATTTACTCAAAAAAATGTTAGATGCTCGTCCTGAACACAGATTTTCA
GCTACTTAATGCTTATAACATCCTTTCTTGCATCTCGATGGAGAATATTAACCTGGCGAT
ATTTCTTGTGGCAACTTGGGATCTTATGAAGTAGAATTCTTAGCTAATGTTCGTAACAAA
TAGTTAGACTCTTAAGAAATGATTGGATCTTTAGCTTTACACTCAACTGGAAAATTACCA
ATCAATGGTAATGTGAATACTATCGGATCTCTCTCAACTTACTCTAACTCATCTATCACT
AATCTTGAAAGAAAAAATACTTCTTCAGGTCCTGGTGCAAGTATCTTTAATAAAGGAAGA
TCAGACAGTATAGATTAAAATATGACCGGCACTCCCTCTAGCCGTAAATCTAACAACAAT
TCACTATTCAAGGCAACATTGATCAAAAACAGTTATCACACCTCATAATTTGGTGGTAAC
GAAGAAAGAAAAGGTAGAGATGATGAATACGAAGAAAATTGTGATGTTGGTGAGGAAAAC
TCTCCTGTTTGCAATTCAGTTAACAAAATGAATATAGAAAAATCAATGAAGCACAATCCT
TCTAAATGCGATGAATCCTCTAACTCTCCTAAATCTGCAGGTACTATAGGTACTCCAACA
AACTCTGCAAAGTATGGAAAATCTACTATAGCAAAGAAATGA


>TTHERM_00523000(protein)
MKPASFFDDDYGKLQKKIWDPVPGNKTVSNLETVYLCNQFYKRSKKVGKSKQIYYVLTEE
GLYQVKKNEVLCGFMDLTCVKMDLLIEVQDAKTIDTSLDSNPNNVHGFRLSRNGKSIEFY
TNDNLLYKNWKNVLIYRCIQSTFHEEFIVTKMIGKGSFAKVYLATKKSQNIQYAIKAFNK
EFMQNQHKGKESLINEISIMRQLNNDHLIRLYEVYETTNSIYFVVDLLNGGELLHRIREK
GSINEKELRVLIRNLILALEHLHQKNIMHRDLKPENLLLKSKQSDSEIVVADFGLATRID
IPNILFKRCGTPGFVAPEVLLYKEGDPFYTTQCDIFSAGIIFYLLLVGKQPFQGKDYKQI
LRANKACEIRYDLPEFEKISNAAKDLLKKMLDARPEHRFSATQCLQHPFLHLDGEYQPGD
ISCGNLGSYEVEFLANVRNKQLDSQEMIGSLALHSTGKLPINGNVNTIGSLSTYSNSSIT
NLERKNTSSGPGASIFNKGRSDSIDQNMTGTPSSRKSNNNSLFKATLIKNSYHTSQFGGN
EERKGRDDEYEENCDVGEENSPVCNSVNKMNIEKSMKHNPSKCDESSNSPKSAGTIGTPT
NSAKYGKSTIAKK


>TTHERM_00523000(gene)
ATGAAGCCTGCATCATTTTTTGACGACGATTATGGAAAATTACAAAAGAAAATCTGGGAT
CCAGTACCCGGCAATAAGACTGTTAGCAACCTTGAAACTGTTTATTTATGCAATCAATTT
TATAAGAGATCAAAGAAAGTAGGTAAATCTAAGCAAATCTACTACGTTCTCACTGAAGAA
GGACTCTATTAAGTTAAAAAAAATGAAGTACTTTGTGGTTTTATGGATTTAACTTGCGTT
AAGATGGACCTCTTGATAGAGGTTTAGGATGCTAAAACTATAGACACAAGCTTGGACAGT
AATCCTAATAATGTTCATGGATTCCGTCTTTCCCGTAACGGCAAATCAATTGAATTCTAC
ACAAATGATAACTTACTCTACAAGAATTGGAAAAATGTCCTTATCTATCGTTGTATTTAA
AGTACTTTTCATGAAGAGTTTATTGTAACCAAGATGATTGGTAAAGGTTCTTTTGCTAAA
GTCTATCTTGCAACAAAGAAGTCATAAAATATCTAATATGCAATTAAAGCCTTCAATAAA
GAATTCATGCAAAATTAGCACAAAGGTAAAGAGTCCTTAATAAATGAAATTTCGATTATG
CGTTAATTGAACAATGATCATTTAATCCGTCTTTATGAAGTATACGAAACCACTAACTCC
ATTTACTTTGTTGTTGATCTCTTGAATGGTGGTGAATTACTTCATCGTATTCGTGAAAAA
GGATCTATAAATGAAAAGGAGCTCCGTGTCCTAATACGTAATCTTATTTTAGCCTTAGAG
CATCTCCATTAGAAGAATATCATGCATAGAGATTTAAAGCCAGAAAATCTCCTTTTAAAG
TCAAAATAATCTGATTCTGAAATTGTCGTTGCTGATTTTGGTCTTGCTACTCGTATAGAT
ATTCCTAATATTTTGTTTAAACGTTGCGGTACTCCTGGTTTTGTAGCTCCTGAAGTTCTC
CTTTACAAGGTAAATAAATAATGATTTTTAAACTAAACAAGTCACATCATCTTATCAATT
TAATAATCAATATAAGAAAACCAGTTTATTTTTAATTCTATTTTAACATTATTTCCTAAA
AATTATAAAAATCAAATTAAATTGCATCATTTTGCTAATTTTTTGCCAGCAATCATAACT
TATGCAGTAAATTATATTTAATTTCTACTTATTTAAAATGCTACAAAGATTAAAAATTAG
ATGTATCTATATTATAAACCTAAAATCTTACAATTTATTGTTCATTATTTAGGATTTAAT
AGTTTTTTTATTGAGTTGCTAAATACACCAAAAACAATCAAAGATACCAATCAAGCGCTT
ATTCTTAAATTATTTAGTCATCATAATTATTTAAATTAGGTTCTATATAATAAATAGTAT
AGCCATATCATACCATCTAATAAAAAAACATTTTAAAATCAGCTTTAGGTTTATAGTTTA
AAATATAATTTAGCTGAAGTTAAAAATGGAAGAACAATTTAATATTTAGCATTAATAAAA
AATAGGTAGATCTATCTAATTATTTAAATAATGAATGAGTCAAATTTTTTTTTTAAACTA
ATTAAAAATAATTAAGGAATTTGAAATAAACTTTTTTAAAAAAATATCTAAAAATAAATA
AATAAAATAATGAATGAATGAATAAAAAATTAAGTAATTATAGTCAAGCAAAATATAGTT
TAAATATTTAAATAGCTATTTATTTATCTACAACTGACTTATTTTTCTAATAAGTAACTA
AAATAAACAAACAAAAGCAATTTTTATTTATTAACAATAAATTTTGATAACAAATAGACA
TTTTAATTCTTATATTGTTTTGTTTTTAATCTATTTTAATTAATGCAAATTATTTTTTAA
AATATTAGGAAGGTGATCCTTTTTACACTACTTAGTGCGATATTTTCTCTGCTGGTATAA
TATTCTATCTCTTATTAGTAGGAAAGTAGCCATTCTAAGGAAAGGACTATAAGTAGATTC
TAAGAGCAAATAAGGCTTGCGAAATTAGATATGATTTACCAGAGTTTGAAAAAATTTCTA
ATGCTGCCAAAGATTTACTCAAAAAAATGTTAGATGCTCGTCCTGAACACAGATTTTCAG
CTACTTAATGCTTATAACATCCTTTCTTGCATCTCGATGGAGAATATTAACCTGGCGATA
TTTCTTGTGGCAACTTGGGATCTTATGAAGTAGAATTCTTAGCTAATGTTCGTAACAAAT
AGTTAGACTCTTAAGAAATGATTGGATCTTTAGCTTTACACTCAACTGGAAAATTACCAA
TCAATGGTAATGTGAATACTATCGGATCTCTCTCAACTTACTCTAACTCATCTATCACTA
ATCTTGAAAGAAAAAATACTTCTTCAGGTCCTGGTGCAAGTATCTTTAATAAAGGAAGAT
CAGACAGTATAGATTAAAATATGACCGGCACTCCCTCTAGCCGTAAATCTAACAACAATT
CACTATTCAAGGCAACATTGATCAAAAACAGTTATCACACCTCATAATTTGGTGGTAACG
AAGAAAGAAAAGGTAGAGATGATGAATACGAAGAAAATTGTGATGTTGGTGAGGAAAACT
CTCCTGTTTGCAATTCAGTTAACAAAATGAATATAGAAAAATCAATGAAGCACAATCCTT
CTAAATGCGATGAATCCTCTAACTCTCCTAAATCTGCAGGTACTATAGGTACTCCAACAA
ACTCTGCAAAGTATGGAAAATCTACTATAGCAAAGAAATGA