Identifiers and Description

Gene Model Identifier

TTHERM_00522710

Standard Name

None

Aliases

PreTt12386 | 65.m00204 | 3717.m00083

Description

ribosomal large subunit pseudouridine synthases, RluD subfamily protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01479 ) S4 domain
  • ( PF00849 ) RNA pseudouridine synthase
  • ( TIGR00093 ) conserved hypothetical protein
  • ( TIGR00005 ) pseudouridine synthase, RluA family
  • ( TIGR01621 ) pseudouridine synthase Rlu family protein,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.9%

TetraMine Data

TTHERM_00522710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12836.19.997093137033517e-262pseudouridine synthase, RluD s
ubfamily protein (446 aa)
OxytrichaContig21759.0.g272.000065869309806e-55RNA pseudouridylate synthase
SGDYOL066C5.999013395827003e-54RIB2 Bifunctional enzyme with
DRAP deaminase and tRNA:pseudo
uridine synthase activity; the
deaminase catalyzes the third
step in riboflavin biosynthes
is and the synthase catalyzes
formation of pseudouridine at
position 32 in cytoplasmic tRN
As
DictyBaseDDB_G02810971.9998745702418095e-48DDB_G0281097 on chromosome: 3
position 4057793 to 4059529
WormBaseWBGene000194982.9986404383886433e-43Uncharacterized protein K07E8.
7 status:Confirmed UniProt
:O16686 protein_id:CCD72759.
1
Stentor CoeruleusSteCoe_243752.1705220113036395e-29

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00522710(coding)
ATGGAAGTTTTTAACAACTCAATTAAGCCAACCTACTTCTTTCATGGGCCTTTTAGATTT
GTGAAGGCTTATGAGCATTGTTTCCGCACTCACTCAAAAGGTAGATGGGTCGGAAATCCT
ATTTTAGAAGTCCTTGAAAAGGAGTTTCATGCATACACTAAAGAATATTATCAAAATGCT
ATAGAAAAAGGAAAAATTCTAGTAAATAAATAAAAGCAAAATATAGACTATCGTTTTAAG
CACAATGACTTATTTGAGCACTTCACTAGTAGAGTAGAACCACCAATAATTAATCTTTTA
CCAAAAGTGATTTTTGAAGATGATAAATTGTTAGTACTCAGTAAGCCTCCTTATATTAGC
GTTCACGCCTCAGGAGGATTTCATTTTAACTCTCTAGTTGGATTACTCAAATTTGAAATG
GGTTACAACATAGAATTATATGTGCTGCATAGATTAGATAAGCTGACTTCAGGAGTTTTA
ATTATGGCCAAAGATAGGGATTTAACTAAAAAATTTCATGAATCTGAAACTGAGTTAATT
AAAAAAACATATTTGGCTCGTGTTCATGGAAATTTCAATCATCAGTACTTAGAATATGAA
AAGCCTATTTATTGTATTTATAAGAAGGTAGGAACCTATGCCGTATTAGATACAACTGAT
GAAGAAGAAATAAAATCTAAAGGAGCTAAATAGTCAAAAACTATATTCAAAAAAATATGG
TATGATGAAAAGAGTGATTCATCCCTTTTAGAATGTTAGCCAATAACTGGCAGAACTCAT
TAAATTAGAGTTCATTTAAGTAGTCTTGGTTTTCCTATTATAAATGATACTTAATATGGC
GGCTAATTTTTAGGAAATGGAATAATCAAGGTGAAATTCCCAGAAATATATACTGGTTTA
AAATCTGAAAAAGCATAAAATCCCTAATCAATCTCATAAAGCTTAATTGAGTCAAATTAA
GAGGAGTGTGTAGAAACAATTCAAAAAAAACATAAAAACAATGAAGGGGATGCCTCAACT
AGCAAAGAAAAAGTAGTAATTTAGAATTAAGTCGAGAGTCATGAGAATGAAAAAAATAAA
TAAGATGATTCAAATGAAGAGCAAAAGCATGAACATAATTAAAAAGATTTAAAGGAAGTA
GGTGAAGATGGATCTTATATGTTATCTCAAGAAAATGGTCTTTACAAATTAGAAGGTAAT
TTGGTAGAGGATTATGAGTGGGATTATAAAAATTAGCCTTTAGAAATTTGCTTGCATTCT
ATGAAATATATTTTCTAATCATATATTTTTGAAGACGAAAAGCCTTATTGGGCTGACTAG
AACTTTTCTTTCTAAGATTGA


>TTHERM_00522710(protein)
MEVFNNSIKPTYFFHGPFRFVKAYEHCFRTHSKGRWVGNPILEVLEKEFHAYTKEYYQNA
IEKGKILVNKQKQNIDYRFKHNDLFEHFTSRVEPPIINLLPKVIFEDDKLLVLSKPPYIS
VHASGGFHFNSLVGLLKFEMGYNIELYVLHRLDKLTSGVLIMAKDRDLTKKFHESETELI
KKTYLARVHGNFNHQYLEYEKPIYCIYKKVGTYAVLDTTDEEEIKSKGAKQSKTIFKKIW
YDEKSDSSLLECQPITGRTHQIRVHLSSLGFPIINDTQYGGQFLGNGIIKVKFPEIYTGL
KSEKAQNPQSISQSLIESNQEECVETIQKKHKNNEGDASTSKEKVVIQNQVESHENEKNK
QDDSNEEQKHEHNQKDLKEVGEDGSYMLSQENGLYKLEGNLVEDYEWDYKNQPLEICLHS
MKYIFQSYIFEDEKPYWADQNFSFQD


>TTHERM_00522710(gene)
ATGGAAGTTTTTAACAACTCAATTAAGCCAACCTACTTCTTTCATGGGCCTTTTAGATTT
GTGAAGGCTTATGAGCATTGTTTCCGCACTCACTCAAAAGGTAGATGGGTCGGAAATCCT
ATTTTAGAAGTCCTTGAAAAGGAGTTTCATGCATACACTAAAGAATATTATGTAAAATAT
AGAAAGATTATTAGCAAAATTAACCTAAATATGCTTCTTAAATTTAAAAAATACTAATTT
AAAAATGAAACAATTGCTATGTTAATTAGCTTAATTACATTTTATTATCATTTAAAATAT
TTTTATATTGAAAAATAAGCAAAATGCTATAGAAAAAGGAAAAATTCTAGTAAATAAATA
AAAGCAAAATATAGACTATCGTTTTAAGTAAAATCTTTAAGATTAGAAAATTATTATAAA
AAACTTTAAATTGAAATAATATATGTTATAATTTGAATTTTACTGTGAATAATTAGATTA
CAGTTAATAATATTAATATAATTAAATGTGATCATTTAACTTTATAGGCACAATGACTTA
TTTGAGCACTTCACTAGTAGAGTAGAACCACCAATAATTAATCTTTTACCAAAAGTGATT
TTTGAAGATGATAAATTGTTAGTACTCAGTAAGCCTCCTTATATTAGCGTTCACGCCTCA
GGAGGATTTCATTTTAACTCTCTAGTTGGATTACTCAAATTTGAAATGGGTTACAACATA
GAATTATATGGTAAAAGCAAAATAATTTTCATATTTTAATTTTAACACTTTTTAATAATA
AACGTATATACAGTGCTGCATAGATTAGATAAGCTGACTTCAGGAGTTTTAATTATGGCC
AAAGATAGGGATTTAACTAAAAAATTTCATGAATCTGAAACTGAGTTAATTAAAAAAACA
TATTTGGCTCGTGTTCATGGAAATTTCAATCATCAGTACTTAGAATATGAAAAGCCTATT
TATTGTATTTATAAGAAGGTAGGAACCTATGCCGTATTAGATACAACTGATGAAGAAGAA
ATAAAATCTAAAGGAGCTAAATAGTCAAAAACTATATTCAAAAAAATATGGTATGATGAA
AAGAGTGATTCATCCCTTTTAGAATGTTAGCCAATAACTGGCAGAACTCATTAAATTAGA
GTTCATTTAAGTAGTCTTGGTTTTCCTATTATAAATGATACTTAATATGGCGGCTAATTT
TTAGGAAATGGAATAATCAAGGTGAAATTCCCAGAAATATATACTGGTTTAAAATCTGAA
AAAGCATAAAATCCCTAATCAATCTCATAAAGCTTAATTGAGTCAAATTAAGAGGAGTGT
GTAGAAACAATTCAAAAAAAACATAAAAACAATGAAGGGGATGCCTCAACTAGCAAAGAA
AAAGTAGTAATTTAGAATTAAGTCGAGAGTCATGAGAATGAAAAAAATAAATAAGATGAT
TCAAATGAAGAGCAAAAGCATGAACATAATTAAAAAGATTTAAAGGAAGTAGGTGAAGAT
GGATCTTATATGTTATCTCAAGAAAATGGTCTTTACAAATTAGAAGGTAATTTGGTAGAG
GATTATGAGTGGGATTATAAAAATTAGCCTTTAGAAATTTGCTTGCATTCTATGAAATAT
ATTTTCTAATCATATATTTTTGAAGACGAAAAGCCTTATTGGGCTGACTAGAACTTTTCT
TTCTAAGATTGA