Identifiers and Description

Gene Model Identifier

TTHERM_00522150

Standard Name

MRNO20 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt12330 | 65.m00148 | 3717.m00027 | TKL1

Description

TKL1 tyrosine kinase family protein; Protein with predicted MORN domains localized throughout the protein and/or associated with other domains having a predicted function; Protein kinase domain. Sequence similarity to the TKL protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02493 ) MORN repeat
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF00536 ) SAM domain (Sterile alpha motif)
  • ( PF07647 ) SAM domain (Sterile alpha motif)
  • ( PF02198 ) Sterile alpha motif (SAM)/Pointed domain
  • ( PF06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00522150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12893.19.997093137033517e-262kinase domain-containing prote
in (1319 aa)
OxytrichaContig3139.0.g829.000650761534676e-74Protein kinase domain
DictyBaseDDB_G02897094.000904604388404e-59drkB on chromosome: 5 position
3147575 to 3149927
WormBaseWBGene000000189.99648502569394e-38locus:abl-1 Tyrosine-protein
kinase abl-1 status:Partial
ly_confirmed UniProt:P03949
protein_id:CAB60296.2
SGDYAR019C8.99768837233868e-29CDC15 Protein kinase of the Mi
totic Exit Network that is loc
alized to the spindle pole bod
ies at late anaphase; promotes
mitotic exit by directly swit
ching on the kinase activity o
f Dbf2p; required for spindle
disassembly after meiosis II
Stentor CoeruleusSteCoe_14693.532628572200807e-24

General Information

Paragraph NoGene NameParagraph Text
121MRNO20Tetrahymena thermophila’s MRNO20 protein is homologous to proteins from the 1APM superfamily, which is associated with transmembrane receptor linked kinases and other cytoplasmic proteins, and the 1B0X superfamily. It contains three domains, the first being composed of six Morn Repeats (E-value= 1E-10 to 1E-22) at the N terminus. The next domain is SAM 1, which functions in protein kinase cascades and RNA binding (E-value= 1.3E-9), and correlates with homologs in the 1B0X family. The eighth domain is tyrosine kinase protein, which transfers a phosphate group from ATP to another protein in signal transduction kinase cascade and homologs with transmembrane receptor linked kinases, specifically in cell division (E-value= 3.3E-66). The closest homologs are I. multifiliis, a disease in freshwater fish, P. tetraurelia, a ciliate common in ponds, and P. persalinus a disease of mariculture fish. MRNO20 is an essential protein that are integral in cell division, in which mutations can lead can lead to Parkinson’s disease and gastric cancer in mammals. Paragraph by: Kate DeMarsh, Ananya Venkatesh, Scripps College

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00522150(coding)
ATGAAAAGTCAAACAAATAAGTAGGGAGCTAGGCATGGATAAGGTATGATGCACTATAAC
AATGGAGATAAATATGAAGGTGAATGGTATAATAATCTGAGATAAGGATAGGGTAAATAA
TACTATTATAATGGAGATTTTTATACTGGATCATGGAATAAAGATAAAAAAGAAGGCCAT
GGTTAATATTTCTATTCAAATAATGAAAGATATGAAGGTGATTGGTCTAATGATTTAAGA
CATGGAAAAGGAAAGTATTTTTATAGAAATGGAGATATTTATGATGGTTCATGGGTGAAA
GGGAAAAAAGAGGGTAAAGGAAGAATGACATACTACAATAATGAAGAATATGATGGCGAT
TGGTTAAATGATAAAAAGCACATCAAAAATAGTACTCAAAATAATGAATCAAAAGAAGAA
AATAACCATAAGAGAAGAAAAAATGGATAAGAAGATAATTCAAATACTAATTCTTATGAA
GAGAAGAATTCAATTGATTAGATAAGAAAAGTAATCTCTAACGGCTCAGAAAGAAAAAAT
AGTTCTCCTAAAAATAAAAAGAGTATACAAGATGATAAAGATTACGAATATGATTACAAT
AAGCCTAGCTCTAATAATATAAAAGAAGAAATTTAAAACAATCTATTTAGCAATAATTAA
ATAAATTCAAATATTTTAGAAAGCTAGCAACTGCAATACACAAATCAATATCACAGTAAT
AGAGACAATGACTTCGCTATAGCTACAAATGTAGAAGAAAGTGTTTCTAAATCTAATATA
ATTGCAACTGAGGTTAATGACACATATCGAACGAATGGATAGAGTTTATAGATTTCTATA
GATGATAACAAGGCTATTGATATATTAGATATTATGGAGAGCTATGAAATATTAAATAAT
TTCCCTTAAGATTTAAGAGAATGGAATACGGGACACATTTGCAAGTGGCTAGATTCAATA
GGTTTAGGTGAATTCAGCCCTTCTTTTGAAAGTAATTAAATATGTGGATAGAGTATTTGT
ATGCTAACCGAGTAAGAATTAGAGCAATCAATAGGAATGAAGGCTTTAGGTAAAAGAAAA
ATCTTTTTGAAGTATTAAGAAATGCTCAAAAAGTACTATAACAAGAAATTAAGTAAAGAC
ATTAAGCAATTCATCCATAAGCATTAGTCTAGATTCAAAAAAGGAGAGAAGAGTTTATAG
TTTCTCAAGCAAAATTAATAAAACTACAGAAGTATAAGGGAAGAGGACGAAAGTATTTCT
TCTCACAAAAATTCCTTAAATTCTAATTAAATAAATCAAATGGAAAATTTTATGCTGCTT
GAAGAAGACGAAGATGAAGATCATAGTGGAGGTAAAAAACAGAAGGATAAAGACAAAAAA
AATAACAGCTACAGAAATTCAGATGATGAATAAAATAAAGAAAAAAACGAAAATAATAAA
AAAAATTAAAAAATAAAGAAAAAAAAGAGAGATAAAGGAAGTAACAATAGTTCATCTAAC
GATGAAAGCGACTATTCTTAATCAGATAACTAAAAAGTCAGCGGTTTAAGGAGCAGAGAG
AATTCTGGTTCTAATTTAGTAAATGTAAAGGAAGACCAAAAAGAAAAGAAACAAAAAAGA
AATTCTCCTTAGTATTAGTATATCAACAATAACAACAACAATTTTGAAGAAAATTACAAA
TACAAATAAAAAGACAAATCTAAAAATTTTGCTGGAGACGAAGATGAAGAAATTCATAAG
TTTTTAAAGTTTTAAAAGAATAAGTCCTAGACAGAGTAACAAAAGCATCATAATAATCAT
ATATCTAAAGTTTAATCAGACTCAACATATAACTCACATAAGTTAAAAATTCAATAAATA
AATAACGTCTACTGTGAAGACAAGCTATTTTAAGATATTAAAGTTGAAAAAAAATAGAAC
CATAAATAGTCTGGCGATTATGCTCAAAATATCTAATCAGAATCTTTACTCACAGAGTAA
AACTAAGAGCTAGCTTACACGATATCCAATGGGAATTATTAAAATTAAGATATTCAAACA
GCACAAGACTTAAATTAAAATAATATTTAAGAAGAAGAAATAAAAAATTAAAAATAATTA
TCAAAAGAGGTAAACAAAACTCAAAGTCTTGACAATTCATATGTTAAAAAGAAAAAGAAA
GATGATAAACTTGGCCCAAGAGATGGTAAATTTAACAATAATAGTATAGAGTCCATTGAT
ACCTTAGAGCAAAAATAACATAAATCTGATGATGCTGCCTCAGTAAATTAAATGAACAGC
CCTGATATTAGATAAAACGATTTGATTAAATCTTTGCAACCGGATTTTATCAACACAAAG
CCATTCATTTTAAATTTTAATTAATCTATTAACTAAAATGAAAACACTCTTTTTAAGCTT
GGAATATAAAAAGATCTTTTCATAAGTGACAAAAATGACAGTCAAAAAACTGGATTGACA
AAAATTACATCTTCAAACTAATCAGGTGGTTAAACTTTGATTAATTAATCATCAGGGGCA
ATTGGAAATCCTACAGCTCAAAATTCGAGTGTCGAAAATAACTCTGGTTAAAATAAAGGA
ATGTAAATAAGCAACAATCAGCTTTCTTCTTCCAGCTCTTCTTCTGATGAGTCTTCAGAT
AATGAACCTAATAAGCAAGTAGTAAATAAGAGATCAAAGGGAGATGGAGGTGCTTCTATA
TCGAGCTAAGATTCAGATACAAATTCAAAACTTAAACAAAGATAGACACCTCAATAAAAA
TTTAAAAAAGAAAATACAAAAGATGGAAGCAGAAACCCTAGCAAAGATAAAGCTACTCCT
CAAATTAAACATAAAGATAAAGATAAAGATAAAATGAAAGAAGTTAGTAAAGAAAAATCA
AGGTTAAGAAGAGAAGAAAAATAATAATAGTTGGATTAACTACTGAGAGACATGGGTATC
AATAAAAAACTTATTATAAATTACTAAGAACTTGATTTTGGAAAAAAAATCGGAGAAGGA
AGTTATGGTTAAGTATTCAAAGGTACATGGGCCAAAACTCAAGTTGCTATTAAATAATTC
GGAAAATAAAATTCGAAATTCCACCTTAGAAAAGTTTAAGATTTTATATCAGAAGTTCGT
GTTATAAACAATCTAAGACACCCAAACATCGTTTTATATATGGGTGTTTGCTTTTATCAG
TCACAATATTTTATGATTACAGAATATTTACAAGAAGGTTCATTATACGATCATTTACAT
ATCAAGCATACAGCTTTTAGCGAAGCTAAATAAATTGATATGATAGAAGATATGGCATTA
GGAATGGTATATTTACATGGAAGAAAAGTAATGCATTGTGATTTGAAGAGCTCAAACGTT
TTAATAGATGAAAATTGGAATGTTAAGCTTTGCGATTTTGGGCTTTCAAGAATTAAATCA
ACACTGAATAAAAAGAAAAATGCTCGTAAAAATGAAGGCTTAATTGGAACTCCATAATGG
ATGGCACCAGAAATTATGAGAAGAGAGTAATATTAAGAGCATTCTGACGTCTACTCGTTT
GGCATGATTATGTGGGAAATTGCTACGAGAAAAGTACCTTATTTGGGTCTATCTCATTAG
TAAATTTATGGTACTGTAGGATATGATGAAAATTATTAAGTAGAAATACCTGTAAGAGGA
ATACCTAGATATTTGAATCTAATGAAAAAATGTTTAAGAAGAAACCCATAAGAAAGACCT
ACTTTCTAAGAAGTAGTTGAAGAAATTTTTAAAATAAAAAAAGATCTTAAAGATAATAAT
AAAAAATAAGTAGTAAAAGAAATCATAAGATTCTTTGATTGA


>TTHERM_00522150(protein)
MKSQTNKQGARHGQGMMHYNNGDKYEGEWYNNLRQGQGKQYYYNGDFYTGSWNKDKKEGH
GQYFYSNNERYEGDWSNDLRHGKGKYFYRNGDIYDGSWVKGKKEGKGRMTYYNNEEYDGD
WLNDKKHIKNSTQNNESKEENNHKRRKNGQEDNSNTNSYEEKNSIDQIRKVISNGSERKN
SSPKNKKSIQDDKDYEYDYNKPSSNNIKEEIQNNLFSNNQINSNILESQQLQYTNQYHSN
RDNDFAIATNVEESVSKSNIIATEVNDTYRTNGQSLQISIDDNKAIDILDIMESYEILNN
FPQDLREWNTGHICKWLDSIGLGEFSPSFESNQICGQSICMLTEQELEQSIGMKALGKRK
IFLKYQEMLKKYYNKKLSKDIKQFIHKHQSRFKKGEKSLQFLKQNQQNYRSIREEDESIS
SHKNSLNSNQINQMENFMLLEEDEDEDHSGGKKQKDKDKKNNSYRNSDDEQNKEKNENNK
KNQKIKKKKRDKGSNNSSSNDESDYSQSDNQKVSGLRSRENSGSNLVNVKEDQKEKKQKR
NSPQYQYINNNNNNFEENYKYKQKDKSKNFAGDEDEEIHKFLKFQKNKSQTEQQKHHNNH
ISKVQSDSTYNSHKLKIQQINNVYCEDKLFQDIKVEKKQNHKQSGDYAQNIQSESLLTEQ
NQELAYTISNGNYQNQDIQTAQDLNQNNIQEEEIKNQKQLSKEVNKTQSLDNSYVKKKKK
DDKLGPRDGKFNNNSIESIDTLEQKQHKSDDAASVNQMNSPDIRQNDLIKSLQPDFINTK
PFILNFNQSINQNENTLFKLGIQKDLFISDKNDSQKTGLTKITSSNQSGGQTLINQSSGA
IGNPTAQNSSVENNSGQNKGMQISNNQLSSSSSSSDESSDNEPNKQVVNKRSKGDGGASI
SSQDSDTNSKLKQRQTPQQKFKKENTKDGSRNPSKDKATPQIKHKDKDKDKMKEVSKEKS
RLRREEKQQQLDQLLRDMGINKKLIINYQELDFGKKIGEGSYGQVFKGTWAKTQVAIKQF
GKQNSKFHLRKVQDFISEVRVINNLRHPNIVLYMGVCFYQSQYFMITEYLQEGSLYDHLH
IKHTAFSEAKQIDMIEDMALGMVYLHGRKVMHCDLKSSNVLIDENWNVKLCDFGLSRIKS
TLNKKKNARKNEGLIGTPQWMAPEIMRREQYQEHSDVYSFGMIMWEIATRKVPYLGLSHQ
QIYGTVGYDENYQVEIPVRGIPRYLNLMKKCLRRNPQERPTFQEVVEEIFKIKKDLKDNN
KKQVVKEIIRFFD


>TTHERM_00522150(gene)
ATGAAAAGTATGAAGGTAAATTAATGAATAAAATTTTTTTATAATATAATTAAAGCAAAT
TACGAGAATTCAAACACAAAATTATCAATTTAAATTTAAAAATATCCATTTTATCTAATA
TTAAAAACATTACACATAGGATTCAATTTTACTATATTGTTTAAATAGGTCAAACAAATA
AGTAGGGAGCTAGGCATGGATAAGGTATGATGCACTATAACAATGGAGATAAATATGAAG
GTGAATGGTATAATAATCTGAGATAAGGATAGGGTAAATAATACTATTATAATGGAGATT
TTTATACTGGATCATGGTAATAAAAGAGTTTTTTGAGCAAACAATTTTAAATATTCTTAT
TTTTTATATAAAACGATACAAAAAATAACTAAAATAAAATATATTTTTATTTAAAAATAA
AAGGAATAAAGATAAAAAAGAAGGCCATGGTTAATATTTCTATTCAAATAATGAAAGATA
TGAAGGTAATATACTATTAAACATTTTGATTAAAACATATTTGAAAATAGTACTTAAATT
TATCTATTACCTATTTTTATCAGGTGATTGGTCTAATGATTTAAGACATGGAAAAGGAAA
GTATTTTTATAGAAATGGAGATATTTATGATGGTTCATGGTAAAAAAATATTTGAGTCTA
AGGGTGTAATTCATGTTAATATTAATTTAGGGTGAAAGGGAAAAAAGAGGGTAAAGGAAG
AATGACATACTACAATAATGAAGAATATGATGGTACTTTTTAATTCAGCATCAATAAAAA
ACCAAATATTAAATTAATAATTAATTAGGCGATTGGTTAAATGATAAAAAGCACATCAAA
AATAGTACTCAAAATAATGAATCAAAAGAAGGTATTTTTTAATTGCTGGCTCTATAAAAA
GTTAATTTTTTTTATATTTATATTCAAGAAAATAACCATAAGAGAAGAAAAAATGGATAA
GAAGATAATTCAAATACTAATTCTTATGAAGGTAAATTTATCAAAAAGTAAAATTTAAAA
ATATTTATTAAATAATTTTATGCTTAAAATAGAGAAGAATTCAATTGATTAGATAAGAAA
AGTAATCTCTAACGGCTCAGAAAGAAAAAATAGTTCTCCTAAAAATAAAAAGAGTATACA
AGATGATAAAGATTACGAATATGATTACAATAAGCCTAGCTCTAATAATATAAAAGAAGA
AATTTAAAACAATCTATTTAGCAATAATTAAATAAATTCAAATATTTTAGAAAGCTAGCA
ACTGCAATACACAAATCAATATCACAGTAATAGAGACAATGACTTCGTAAAAATTATTTA
ATATAAATTTAGATTTAAAAAATAATTATTTAAACAGGCTATAGCTACAAATGTAGAAGA
AAGTGTTTCTAAATCTAATATAATTGCAACTGAGGTTAATGACACATATCGAACGAATGG
ATAGAGTTTATAGATTTCTATAGATGATAACAAGGCTATTGATATATTAGATATTATGGA
GAGCTATGAAATATTAAATAATTTCCCTTAAGATTGTATAGATTTTTGTTGATACATGAT
TATTTATTGTAATGATATTCTTTTTTAGTAAGAGAATGGAATACGGGACACATTTGCAAG
TGGCTAGATTCAATAGGTTTAGGTGAATTCAGCCCTTCTTTTGAAAGTAATTAAATATGT
GGATAGAGTATTTGTATGCTAACCGAGTAAGAATTAGAGCAATCAATAGGAATGAAGGCT
TTAGGTAAAAGAAAAATCTTTTTGAAGTATTAAGAAATGCTCAAAAAGTACTATAACAAG
AAATTAAGTAAAGACATTAAGCAATTCATCCATAAGCATTAGTCTAGATTCAAAAAAGGA
GAGAAGAGTTTATAGTTTCTCAAGCAAAATTAATAAAACTACAGAAGTATAAGGGAAGAG
GACGAAAGTATTTCTTCTCACAAAAATTGTAAAAATTTAAACCAAATTCATAAATATAAT
CTCATATAAATTTTCTAATTTATTTATTTAGAAATATAATCATTTTATTTTAAATAAAAA
TATTAGCCTTAAATTCTAATTAAATAAATCAAATGGAAAATTTTATGCTGCTTGAAGAAG
ACGAAGATGAAGATCATAGTGGAGGTAAAAAACAGAAGGATAAAGACAAAAAAAATAACA
GCTACAGAAATTCAGATGATGAATAAAATAAAGAAAAAAACGAAAATAATAAAAAAAATT
AAAAAATAAAGAAAAAAAAGAGAGATAAAGGAAGTAACAATAGTTCATCTAACGATGAAA
GCGACTATTCTTAATCAGATAACTAAAAAGTCAGCGGTTTAAGGAGCAGAGAGAATTCTG
GTTCTAATTTAGTAAATGTAAAGGAAGACCAAAAAGAAAAGAAACAAAAAAGAAATTCTC
CTTAGTATTAGTATATCAACAATAACAACAACAATTTTGAAGAAAATTACAAATACAAAG
TAGAGTTAGTTCTTACCAAAATTTTTTAATTTTAAAATATTTTTAAAGTAAAAAGACAAA
TCTAAAAATTTTGCTGGAGACGAAGATGAAGAAATTCATAAGTTTTTAAAGTTTTAAAAG
AATAAGTCCTAGACAGAGTAACAAAAGCATCATAATAATCATATATCTAAAGTTTAATCA
GACTCAACATATAACTCACATAAGTTAAAAATTCAATAAATAAATAACGTCTACTGTGAA
GACAAGCTATTTTAAGATATTAAAGTTGAAAAAAAATAGAACCATAAATAGTCTGGCGAT
TATGCTCAAAATATCTAATCAGAATCTTTACTCACAGAGTAAAACTAAGAGCTAGCTTAC
ACGATATCCAATGGGAATTATTAAAATTAAGATATTCAAACAGCACAAGACTTAAATTAA
AATAATATTTAAGAAGAAGAAATAAAAAATTAAAAATAATTATCAAAAGAGGTAAACAAA
ACTCAAAGTCTTGACAATTCATATGTTAAAAAGAAAAAGAAAGATGATAAACTTGGCCCA
AGAGATGGTAAATTTAACAATAATAGTATAGAGTCCATTGATACCTTAGAGCAAAAATAA
CATAAATCTGATGATGCTGCCTCAGTAAATTAAATGAACAGCCCTGATATTAGATAAAAC
GATTTGATTAAATCTTTGCAGTACTTTTTTTTATTCAAAATTAAAAAATAATTTTAAATA
AACTAAAAATATATAGACCGGATTTTATCAACACAAAGCCATTCATTTTAAATTTTAATT
AATCTATTAACTAAAATGAAAACACTCTTTTTAAGGTAAAAAATTAATTTATCACCTTTT
TTTGAGATTCAGAGATTTAAATTAAAAATTTTATTTAAAACATAATAGCTTGGAATATAA
AAAGATCTTTTCATAAGTGACAAAAATGACAGTCAAAAAACTGGATTGACAAAAATTACA
TCTTCAAACTAATCAGGTGGTTAAACTTTGATTAATTAATCATCAGGGGCAATTGGAAAT
CCTACAGCTCAAAATTCGAGTGTCGAAAATAACTCTGGTTAAAATAAAGGAATGTAAATA
AGCAACAATCAGCTTTCTTCTTCCAGCTCTTCTTCTGATGAGTCTTCAGATAATGAACCT
AATAAGCAAGTAGTAAATAAGAGATCAAAGGGAGATGGAGGTGCTTCTATATCGAGCTAA
GATTCAGATACAAATTCAAAACTTAAACAAAGATAGACACCTCAATAAAAATTTAAAAAA
GAAAATACAAAAGATGGAAGCAGAAACCCTAGCAAAGATAAAGCTACTCCTCAAATTAAA
CATAAAGATAAAGATAAAGATAAAATGAAAGAAGTTAGTAAAGAAAAATCAAGGTTAAGA
AGAGAAGAAAAATGTAATTAACTAACTTTTAATCACAAAAAAACTAACTTTTACAATTCA
TTTAAGAATAATAGTTGGATTAACTACTGAGAGACATGGGTATCAATAAAAAACTTATTA
TAAATTACTAAGAACTTGATTTTGGAAAAAAAATCGGAGAAGGAAGTTATGGTTAAGTAT
TCAAAGGTACATGGGCCAAAACTCAAGTTGCTATTAAAGTATTCATTAAAGAAAATTATT
GTTTATTTAAAAATAAATTTTGTTTTTATAAAAAGTAATTCGGAAAATAAAATTCGAAAT
TCCACCTTAGAAAAGTTTAAGATTTTATATCAGAAGTTCGTGTTATAAACAATCTAAGAC
ACCCAAACATCGTTTTATATATGGGTGTTTGCTTTTATCAGTCACAATATTTTATGATTA
CAGAGTAATTCATTCATAAGTTAACTTGAAATTATTAATTAATTATTTCAAATTATCATA
GATATTTACAAGAAGGTTCATTATACGATCATTTACATATCAAGCATACAGCTTTTAGCG
AAGCTAAATAAATTGATATGATAGAAGATATGGCATTAGGTAATTTAATTGGTTGCCATT
TTATATTTTTCTAATTTAAATGACTATTAGGAATGGTATATTTACATGGAAGAAAAGTAA
TGCATTGTGATTTGAAGAGCTCAAACGTTTTAATAGATGAAAATTGGAATGTTAAGCTTT
GCGATTTTGGGCTTTCAAGAATTAAATCAACACTGAATAAAAAGAAAAATGCTCGTAAAA
ATGAAGGCTTAATTGGAACTCCATAATGGATGGCACCAGAAATTATGAGAAGAGAGTAAT
ATTAAGAGCATTCTGACGTCTACTCGTTTGGCATGATTATGTGGTAATATTATTTTTTTT
AAATATTTTTATTTTAAATAATTAATAAAGGGAAATTGCTACGAGAAAAGTACCTTATTT
GGGTCTATCTCATTAGTAAATTTATGGTACTGTAGGATATGATGAAAATTATTAAGTAGA
AATACCTGTAAGAGGAATACCTAGATATTTGAATCTAATGAAAAAATGTTTAAGAAGAAA
CCCATAAGAAAGACCTACTTTCTAAGAAGTAGTTGAAGAAATTTTTAAAATAAAAAAAGA
TCTTAAAGATAATAATAAAAGTAAATAAATTTCTATAAAATAATTAAAAAAATATTTTCA
AACTCATTTTTTTAAAAAAAAAAGAATAAGTAGTAAAAGAAATCATAAGATTCTTTGATT
GA