Identifiers and Description

Gene Model Identifier

TTHERM_00502430

Standard Name

None

Aliases

PreTt08082 | 63.m00260 | 3716.m00112

Description

kelch motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00502430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09580.19.997093137033517e-262kelch domain-containing protei
n family protein (2078 aa)
OxytrichaContig12560.0.g823.998052787723392e-80Kelch motif
Stentor CoeruleusSteCoe_276821.9792598779469045e-32
WormBaseWBGene000209521.000382677035467e-28locus:kel-8 Kelch-like prote
in 8 status:Confirmed UniP
rot:G5ED84 protein_id:CCD742
70.1
DictyBaseDDB_G02715005.998633383648922e-18keaA on chromosome: 2 position
608312 to 611935

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00502430(coding)
ATGAATTGCCAAGGGTGTAACAATTAATATAATGAAACTGATAGATCGCCAAGACTATTA
ATTAATTGCGGTCATTCAATATGTGAAAAATGTACAGCAGAATTGTATAGAGATGGATAA
ATAGTGTGTCCCGAATGTCGCTTTAAAAATATAGCACCAATGGTTACCTGCTTTCCTAGA
AATTTAGCTTTAATCAATATTAACAAATAGCAACCTTTAGCAAATATGGTAACTCCAGCA
AAAACTAATTTAGGGTTTTAAAGCAGCATTTTATTAAATTCTAACGTTACCTCTCTTTAT
GTAAACAAAGAAAATAATTAAACTACTTAGCAATAAAACTAAAATTTGTAAGGCCTAACT
AATACAAGTTTAAGCAATTTTAAAGCAGCAAATTACATATTATAAGAAATAACACCTCCT
GCAAAATCATAAAGCCAGTAATCTTTTTATCCCAACACTAATACTACCTCAGAACTTAAA
ACATTAGATTCTAATATCAAAGATGCAAATTTACTTTCTGAAAGATATGCTATCTGTTAG
AAGCACTTTAAAAAGTTTGAAGCATACTGTGAAGATGATTAATTATTGCTTTGCATAACT
TGTATTTTGGAAGATGGTCATAGGCAACATTCAATTGATTCTATTGAAAATTCAGTTTAA
AAACAAAAGTAGAAGCAATCAGAGTTCTTTGACTAAAGCAGATAACAAGAAAAAAAAGCA
ATTAACATTATGCAATAAATAGATGCAAATTTGAAAGACCTTTCTAGTTAAGCATAAGTC
TAATTATCAGAAATTTGCAGTTTTTTTAGTGATGTTAAAAAAATTATTAATGAGAAAGAA
AGTAAACTGAAAAGTAAAGTTTAGGATGCATTGCTTGACTAAGAAAATTAAATGAAATAG
CTAGAAAAGTACTATTAAAATCATATATCAGATGTAAATGAGTTTTAAACTTTGTACAGA
CAGTGCTCAGTAATGCAAGATGTTGAATATTTAAAGAGTTTATAAAAAACTAAACAAATT
ATGAGTAAAATAAATTAGGTGTAATAAATAGATAAAATTGAATTTAAGCAGATTTAAAAT
TTCTTTAGTAAAGATTCAGAATTGCATGCATTAACTAAATCAATGCTTTCTCTTCAAACT
TTGAATTAGGCTAACTAATAAAATCCTCTTACAACATAAGTTTAACTAGTACAAACCAAA
AAATAATTGAATTAAGTATAATAAAATAATACTTCTTCCAACAGCAATAAAGAAATTTTA
AACAACAATACTTAAACAAGCAATATAACAAATTAACCTTCAAGTAATGCAATATCTTCA
TCTTCAAACTAAAACCCACAATAATAAAATAAAAAACCTAACACAGTTTATTAAACAGGA
AATAAACCTGCAGTTAAAAGAGTTTAAAATAGGAAAGAGGTTGCTTCTATTGGTCCATTA
GGGATTACATGCGTTTAATAATAAAACATTTATAGAACTAAATCTAATCAAATTATGTAA
AAGAAGGATTAAACTAAAGAAGCAATAGGTACATCCTATGGGAATAATTCAAATTAAAAT
TGTTAGTAAACATTATAGTAAGCAGTAACTACTGGAAATCTAAATATTCAATAAAATTTG
AATTAGGGAAATTACAAACTAGGAAGAAACGATAGGTCTACTTCAAGCACTAACCCTTAA
AGCATTTCAAGTGAGTTAAATAAACCATTAAATAATTACCATGAGCTAAGAAACATACTG
AAGGAAAAACTGACACAATAAAACAACGAATAAAATGTCAATAGAGGAGAAAAGTCATTA
ACTCCTTCTAAAAGGATAAGTAACTATAGTAATAGCTCTTACTAAAATGATAATTTAAAC
TTCTTTAACAAGGAGAAAAATTTACCTAATATTTCTCCGCTAAGGTCAAACAATATAACA
AATATATAGCAACAAGTTTAAAGCAGCAATAATTAATTAAAATAAGTCTTTTAAATTAAT
GAAGGCCTTCCTTTAAATAGTAAAACAATGTACAGCAATGGATAAGCTTAATATAAATCA
ACTGATAAAATTAGTTAGTAGGATTTCAATGATACTACTTAAAAAAGTAGAAGTATTTAT
AAACCTTCCTCTACTCAATCTAAAATTAATTAGATTGGGCAAGGAGATGAGTTAGATGAT
TAAAACTTTTAGTTTATAGACAATAATTCTTATCCAGAATCTGCAAGAAAAGATTTATTT
TAATGCCAAATAAATTCAAATAACTTGAATGTGCTTACCTCAGGATAAAAACCTAACAGT
AACACCAATTCAATAATGAATAGCAATAATTTAATGAAATCTATGAGAACTGATATCACG
GACATGTTTATGAATAGATGCGATTTTTCTACTATATCTACTTACTAAAATGGTAGTTTT
ATCTATGTATTTGGAGGATTTATAGAAAGCAGCTAATATGCAATAGAAAGATTTGACATT
AATAGAAACGTGTGGGAATAAGTTGATATATTACCTACTAATAGAGCTAAATTTTCTATG
GTTGGACTTGATAATGGAAATATTTTAATTATTGGTGGAAAATAGGATGGTATGAGAATA
GCTTTATGTGAAGAATATGATCCTAAAACGAACAAGTTAACCATAAGCAGCATGATGCTT
TCATCTCCTAAAAGTGGATTTGGAGCAGTAAATTTAGGCAGAGATAAGATAATTATAATT
GGAGGAAACGATGGTTAAAATGTACAAGATTTGGTGGAGATGTATGATAAGGCTAGTATG
AAATTGCCAAAAAAACTTTGTTCTATGATTGAAAAAAGAGATGAACTTGCAGTGACTTTA
GGTTTAGACAAAAAAATATATGCTATTGGAGGATTTGGAGGAACGAAGAATGTTTGCCTA
AGAACTGCAGAGCGTTATGATCCAGAAACAGATAGATGGGAGACTATTGCTCCCTTAAAT
GTTCCTAGAAGAGCTCTTGCAGCTGTAACTCTTCCTGATGGAATATATGCAATAGGAGGT
TTTGATGGATAAAACTACTTATCATCTGTTGAAAAGTATGATGAATCATTAAATTAATGG
ATATTTATAAGCAGCATGAACTTTCCTCGTTGTACTTTGAGTGCGGTTACATCAAAAGAT
AATTAATTTATTTATGTGTTAGGTGGGTTTGACAATGGCCCTTTAGATACAGTAGAAAGG
TATAATATATTTGAAGATAAATGGGAAATGTATTCTAAAATGAGTTATAAAAGATTTATG
CATAGTAGCATAATGATCAGTGGATAGTTTGCTTGA


>TTHERM_00502430(protein)
MNCQGCNNQYNETDRSPRLLINCGHSICEKCTAELYRDGQIVCPECRFKNIAPMVTCFPR
NLALININKQQPLANMVTPAKTNLGFQSSILLNSNVTSLYVNKENNQTTQQQNQNLQGLT
NTSLSNFKAANYILQEITPPAKSQSQQSFYPNTNTTSELKTLDSNIKDANLLSERYAICQ
KHFKKFEAYCEDDQLLLCITCILEDGHRQHSIDSIENSVQKQKQKQSEFFDQSRQQEKKA
INIMQQIDANLKDLSSQAQVQLSEICSFFSDVKKIINEKESKLKSKVQDALLDQENQMKQ
LEKYYQNHISDVNEFQTLYRQCSVMQDVEYLKSLQKTKQIMSKINQVQQIDKIEFKQIQN
FFSKDSELHALTKSMLSLQTLNQANQQNPLTTQVQLVQTKKQLNQVQQNNTSSNSNKEIL
NNNTQTSNITNQPSSNAISSSSNQNPQQQNKKPNTVYQTGNKPAVKRVQNRKEVASIGPL
GITCVQQQNIYRTKSNQIMQKKDQTKEAIGTSYGNNSNQNCQQTLQQAVTTGNLNIQQNL
NQGNYKLGRNDRSTSSTNPQSISSELNKPLNNYHELRNILKEKLTQQNNEQNVNRGEKSL
TPSKRISNYSNSSYQNDNLNFFNKEKNLPNISPLRSNNITNIQQQVQSSNNQLKQVFQIN
EGLPLNSKTMYSNGQAQYKSTDKISQQDFNDTTQKSRSIYKPSSTQSKINQIGQGDELDD
QNFQFIDNNSYPESARKDLFQCQINSNNLNVLTSGQKPNSNTNSIMNSNNLMKSMRTDIT
DMFMNRCDFSTISTYQNGSFIYVFGGFIESSQYAIERFDINRNVWEQVDILPTNRAKFSM
VGLDNGNILIIGGKQDGMRIALCEEYDPKTNKLTISSMMLSSPKSGFGAVNLGRDKIIII
GGNDGQNVQDLVEMYDKASMKLPKKLCSMIEKRDELAVTLGLDKKIYAIGGFGGTKNVCL
RTAERYDPETDRWETIAPLNVPRRALAAVTLPDGIYAIGGFDGQNYLSSVEKYDESLNQW
IFISSMNFPRCTLSAVTSKDNQFIYVLGGFDNGPLDTVERYNIFEDKWEMYSKMSYKRFM
HSSIMISGQFA


>TTHERM_00502430(gene)
ATGAATTGCCAAGGGTGTAACAATTAATATAATGAAACTGATAGATCGCCAAGACTATTA
ATTAATTGCGGTCATTCAATATGTGAAAAATGTACAGCAGAATTGTATAGAGATGGATAA
ATAGTGTGTCCCGAATGTCGCTTTAAAAATATAGCACCAATGGTTACCTGCTTTCCTAGA
AATTTAGCTTTAATCAATATTAACAAATAGCAACCTTTAGCAAATATGGTAACTCCAGCA
AAAACTAATTTAGGGTTTTAAAGCAGCATTTTATTAAATTCTAACGTTACCTCTCTTTAT
GTAAACAAAGAAAATAATTAAACTACTTAGCAATAAAACTAAAATTTGTAAGGCCTAACT
AATACAAGTTTAAGCAATTTTAAAGCAGCAAATTACATATTATAAGAAATAACACCTCCT
GCAAAATCATAAAGCCAGTAATCTTTTTATCCCAACACTAATACTACCTCAGAACTTAAA
ACATTAGATTCTAATATCAAAGATGCAAATTTACTTTCTGAAAGATATGCTATCTGTTAG
AAGCACTTTAAAAAGTTTGAAGGTAACACATTTTAGTATATAATCGAATAATAAATTTAA
TGCTTAAATTATAAATATAAAGCATACTGTGAAGATGATTAATTATTGCTTTGCATAACT
TGTATTTTGGAAGATGGTCATAGGCAACATTCAATTGATTCTATTGAAAATTCAGTTTAA
AAACAAAAGTAGAAGCAATCAGAGTTCTTTGACTAAAGCAGATAACAAGAAAAAAAAGCA
ATTAACATTATGCAATAAATAGATGCAAATTTGAAAGACCTTTCTAGTTAAGTAAACATT
TAACAATATCTAAAAATGAGATAAAAATTAAAAAAATTATGTTTTATGTATTAAATTTAA
AAAGGCATAAGTCTAATTATCAGAAATTTGCAGTTTTTTTAGTGATGTTAAAAAAATTAT
TAATGAGAAAGAAAGTAAACTGAAAAGTAAAGTTTAGGATGCATTGCTTGACTAAGAAAA
TTAAATGAAATAGCTAGAAAAGTACTATTAAAATCATATATCAGATGTAAATGAGTTTTA
AACTTTGTACAGACAGTGCTCAGTAATGCAAGATGTTGAATATTTAAAGAGTTTATAAAA
AACTAAACAAATTATGAGTAAAATAAATTAGGTGTAATAAATAGATAAAATTGAATTTAA
GCAGATTTAAAATTTCTTTAGTAAAGATTCAGAATTGCATGCATTAACTAAATCAATGCT
TTCTCTTCAAACTTTGAATTAGGCTAACTAATAAAATCCTCTTACAACATAAGTTTAACT
AGTACAAACCAAAAAATAATTGAATTAAGTATAATAAAATAATACTTCTTCCAACAGCAA
TAAAGAAATTTTAAACAACAATACTTAAACAAGCAATATAACAAATTAACCTTCAAGTAA
TGCAATATCTTCATCTTCAAACTAAAACCCACAATAATAAAATAAAAAACCTAACACAGT
TTATTAAACAGGAAATAAACCTGCAGTTAAAAGAGTTTAAAATAGGAAAGAGGTTGCTTC
TATTGGTCCATTAGGGATTACATGCGTTTAATAATAAAACATTTATAGGTATTAAACGAA
AAAAATTAATATCATTAAATTGCATTTTTATAAAATAGAACTAAATCTAATCAAATTATG
TAAAAGAAGGATTAAACTAAAGAAGCAATAGGTACATCCTATGGGAATAATTCAAATTAA
AATTGTTAGTAAACATTATAGTAAGCAGTAACTACTGGAAATCTAAATATTCAATAAAAT
TTGAATTAGGGAAATTACAAACTGTAAATTGTTTAGTTAAATCATAAGTTTTTTCATATT
TTTTTCCAATTTTAGAGGAAGAAACGATAGGTCTACTTCAAGCACTAACCCTTAAAGCAT
TTCAAGTGAGTTAAATAAACCATTAAGTAATAATTTTTCTTGAATTCTTGACTTTATAAA
AATAATGGTCTTTATTTCAATAGATAATTACCATGAGCTAAGAAACATACTGAAGGAAAA
ACTGACACAATAAAACAACGAATAAAATGTCAATAGAGGAGAAAAGTCATTAACTCCTTC
TAAAAGGATAAGTAACTATAGTAATAGCTCTTACTAAAATGATAATTTAAACTTCTTTAA
CAAGGAGAAAAATTTACCTAATATTTCTCCGCTAAGGTCAAACAATATAACAAATATGTA
ATTTATTTAATTCATTCAGGAAGTTAATTTAAAATAAAAAATGTTTTAACTAGATAGCAA
CAAGTTTAAAGCAGCAATAATTAATTAAAATAAGTCTTTTAAATTAATGAAGGCCTTCCT
TTAAATAGTAAAACAATGTACAGCAATGGATAAGCTTAATATAAATCAACTGATAAAATT
AGTTAGTAGGATTTCAATGATACTACTTAAAAAAGTAGAAGTATTTATAAACCTTCCTCT
ACTCAATCTAAAATTAATTAGATTGGGCAAGGAGATGAGTTAGATGATTAAAACTTTTAG
TTTATAGACAATAATTCTTATCCAGAATCTGCAAGAAAAGATTTATTTTAATGCCAAATA
AATTCAAATAACTTGAATGTGCTTACCTCAGGATAAAAACCTAACAGTAACACCAATTCA
ATAATGAATAGCAATAATTTAATGAAATCTATGAGAACTGATATCACGGACATGTTTATG
AATAGAGTAATTTTTTGTTGAGATATTTTTAGTCTTAATACAATTTAATAAAAAAGTGCG
ATTTTTCTACTATATCTACTTACTAAAATGGTAGTTTTATCTATGTATTTGGAGGATTTA
TAGAAAGCAGCTAATATGCAATAGAAAGATTTGACATTAATAGAAACGTGTGGGAATAAG
TTGATATATTACCTACTAATAGAGCTAAATTTTCTATGGTTGGACTTGATAATGGAAATA
TTTTAATTATTGGTGGAAAATAGGTAATCAATTTTATTTATTAATATTAATATTTATCAT
ATTTGATATAGGATGGTATGAGAATAGCTTTATGTGAAGAATATGATCCTAAAACGAACA
AGTTAACCATAAGCAGCATGATGCTTTCATCTCCTAAAAGTATCTTTGATTTTAAATTTA
TAAATTAATGAAATTAAAATGTTTAAATAATATTTAAAAAGGTGGATTTGGAGCAGTAAA
TTTAGGCAGAGGTAATTAACTACTTTTATATTTAAATGATTTGATTAAAAAATTTTTTAG
ATAAGATAATTATAATTGGAGGAAACGATGGTTAAAATGTACAAGATTTGGTGGAGATGT
ATGATAAGGCTAGTATGAAATTGCCAAAAAAACTTTGTTCTATGATTGAAAAAAGAGATG
AACTTGCAGTGACTTTAGGTTTAGACAAAAAAATATATGCTATTGGAGGATTTGGAGGAA
CGAAGAATGTTTGCCTAAGAACTGCAGAGCGTTATGATCCAGAAACAGATAGATGGGAGA
CTATTGCTCCCTTAAATGTTCCTAGAAGAGCTCTTGCAGCTGTAACTCTTCCTGATGGAA
TATATGCAATAGGAGGTTTTGATGGATAAAACTACTTATCATCTGTTGAAAAGTAAAAAA
ATCTAAAAACAAGAATGTATATAATATTCAAATATTTCTATTGGTTAATAATAGGTATGA
TGAATCATTAAATTAATGGATATTTATAAGCAGCATGAACTTTCCTCGTTGTACTTTGAG
TGCGGTTACATCAAAAGATAATTAATTTATTTATGTGTTAGGTGGGTTTGACAATGGCCC
TTTAGATACAGTAGAAAGGTATTAAAAATTAATTTTAAATAAACTATATAAATTTATATT
AAATTAGGTATAATATATTTGAAGATAAATGGGAAATGTATTCTAAAATGAGTTATAAAA
GATTTATGCATAGTAGCATAATGATCAGTGGATAGTTTGCTTGA