Identifiers and Description

Gene Model Identifier

TTHERM_00502130

Standard Name

None

Aliases

PreTt08052 | 63.m00230 | 3716.m00082

Description

Protein kinase domain containing protein. Sequence similarity to the CDPK protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00502130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09617.19.997093137033517e-262protein kinase domain-containi
ng protein (497 aa)
OxytrichaContig22243.0.g469.000639433685322e-168Protein kinase domain
WormBaseWBGene000067794.998444157800704e-72locus:unc-43 Calcium/calmodu
lin-dependent protein kinase t
ype II status:Confirmed Un
iProt:O62305 protein_id:CAC4
2322.1
Stentor CoeruleusSteCoe_94505.96629836401057e-72
DictyBaseDDB_G02799259.995417076252815e-72mlkA on chromosome: 3 position
2752719 to 2754560
SGDYFR014C6.998463833652622e-61CMK1 Calmodulin-dependent prot
ein kinase; may play a role in
stress response, many CA++/ca
lmodulan dependent phosphoryla
tion substrates demonstrated i
n vitro, amino acid sequence s
imilar to Cmk2p and mammalian
Cam Kinase II

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00502130(coding)
ATGGGATAAAAAGGTAGTAAATAGAATAAAGAAAAGAAGGCAAGGATAGAGCAAACCTTA
AAAGAAGAATAATAAGTTGACACTTCTAACTTTAAGATTTCTAACCAAGAGCTCATTTTC
GAAAAATATGGTAGAATTCAATAAGAATACACCCTCATGAATGTTCCCTTGGGTAAAGGT
TCTTATGGAGAAGTACGTAAAGGTGTTCATAAAAAAACAGGCTAGCAAAGAGCAGTAAAA
ATTATTGATAAAAGCTAATGCAAGCCCGAAGAGTAAAAATAACTCATTGAAGAGTTTAAC
ATCCTTAAATAATTGGATCACCCTAATATCATCAAAGTTTACGAAGTTTTCTAAGACAAC
AAATTCTTATACATAGTTACTGAATTATGTACTGGTGGTGAACTCTTTGATAGAATCATA
GAATACAAGCACTTTAATGAAAAAGAAGCAGCTGATGTTATGTACCAAATCTTAAATGCA
ATTAATTATTTACACAAAAACAAAATTGTTCACAGAGATCTTAAGCCAGAAAATTTATTG
CTTGATTCTAAAAACAAAGATTCTATCCTTAAGCTTGTCGATTTCGGTACTTCTACAGTT
TTTGATCCTTCTTTGAAAATGAGCTAAAAGCTAGGTACTCCTTATTACATTGCCCCTGAA
GTTCTCAGACATAAGTATAACGAAAAATGTGATGTCTGGTCTTGTGGAGTTATTATGTAT
ATTCTTTTGTGTGGTTATCCTCCTTTCAATGCTGCTAGAGATGAAGATATTATGAAAAAA
GTTGAAAAAGGAGTTTTCACATTCCCTAAAGATGACTGGAAAGATATCACAATAGAGGCT
CAGCAAATGATTTGCAAAATGCTTACTATGGACCCCTAAAAGAGATATTCTGCTGAAGAA
GCTCTTTAGGATCCATGGATTAAGAAGTTTAGATAATAATAATAGGTAGATATGCCCAAC
TTAATTAGATCTTTGAATAATATGAAAACATTCAGAGCTGGTAAGAAATTACAAGAAGCT
GTATGGATGTTTATCGTTAACTATTTAGCTACTAAAGAAGAAAAGAATGAACTATTGAAA
ACTTTCTAGTCTTTAGATACCAACGGAGATGGTAAACTAAGTAGAGAAGAACTCATTAAT
GGTTATTCTAAAATCCTAACCATGGAAAATGCCATCAAGGAAGTAGATAAAATTATGAAA
GTTATAGATAAAAACGATAATGGTGATATAGATTATTCTGAATGGGTTGCTGCTACTATT
TCTCGTGAGTAGCTGTTGTCTGTATAAAGATTGGAAATGGCCTTTAATATTTTTGATAAG
GATGGTAGTGGTTCACTCTAGTTAAGTGAATTTAAAGAAATCTTTGGAGGAGCAGGAGTT
TCTGAAGATGTATGGAAGGCTGTCATCAAAGAGGTAGATAAAAATGGAGATGGTGAGATT
TCCTATCAAGAATTCAAAGAGATGATGCTTAAATACATTAAGGATGAAGAGTGA


>TTHERM_00502130(protein)
MGQKGSKQNKEKKARIEQTLKEEQQVDTSNFKISNQELIFEKYGRIQQEYTLMNVPLGKG
SYGEVRKGVHKKTGQQRAVKIIDKSQCKPEEQKQLIEEFNILKQLDHPNIIKVYEVFQDN
KFLYIVTELCTGGELFDRIIEYKHFNEKEAADVMYQILNAINYLHKNKIVHRDLKPENLL
LDSKNKDSILKLVDFGTSTVFDPSLKMSQKLGTPYYIAPEVLRHKYNEKCDVWSCGVIMY
ILLCGYPPFNAARDEDIMKKVEKGVFTFPKDDWKDITIEAQQMICKMLTMDPQKRYSAEE
ALQDPWIKKFRQQQQVDMPNLIRSLNNMKTFRAGKKLQEAVWMFIVNYLATKEEKNELLK
TFQSLDTNGDGKLSREELINGYSKILTMENAIKEVDKIMKVIDKNDNGDIDYSEWVAATI
SREQLLSVQRLEMAFNIFDKDGSGSLQLSEFKEIFGGAGVSEDVWKAVIKEVDKNGDGEI
SYQEFKEMMLKYIKDEE


>TTHERM_00502130(gene)
ATGGGATAAAAAGGTAGTAAATAGAATAAAGAAAAGAAGGCAAGGATAGAGCAAACCTTA
AAAGAAGAATAATAAGTTGACACTTCTAACTTTAAGATTTCTAACCAAGAGCTCATTTTC
GAAAAATATGGTAGAATTCAATAAGAATACACCCTCATGAATGTTCCCTTGGGTAAAGGT
TCTTATGGAGAAGTACGTAAAGGTGTTCATAAAAAAACAGGCTAGCAAAGAGCAGTAAAA
ATTATTGATAAAAGCTAATGCAAGCCCGAAGAGTAAAAATAACTCATTGAAGAGTTTAAC
ATCCTTAAATAATTGGTATGTCATTCAAAAATTCTGACTATTCTTTAATTATTCTTGCTA
TTTTTATTTTATCGTTTTTGCTTAAGTGAAGAGAGTTGAATTTGCTTAAGAGGGTAATCG
CTTTTTTAAATTTTACTTTTCTAAAAATCGTTTTAGAGAAAAAGGAAGAATAAAGCTTAC
CCTTTGCACTACAAGTGTTTGAAAGAATTTAACACTTATTACTCTCAAAACTAATTGCTG
TTCAATTTTATGCAAAAACTAGCTTCACAATTAAAAATTTAATTCTTATTCAAAATTTTA
GGATCACCCTAATATCATCAAAGTTTACGAAGTTTTCTAAGACAACAAATTCTTATACAT
AGTTACTGAATTATGTACTGGTGGTGAACTCTTTGATAGAATCATAGAATACAAGCACTT
TAATGAAAAAGAAGCAGCTGATGTTATGTACCAAATCTTAAATGCAATTAATTATTTACA
CAAAAACAAAATTGTTCACAGAGATCTTAAGCCAGAAAATTTATTGCTTGATTCTAAAAA
CAAAGATTCTATCCTTAAGCTTGTCGATTTCGGTACTTCTACAGTTTTTGATCCTTCTTT
GAAAATGAGCTAAAAGCTAGGTACTCCTTATTACATTGCCCCTGAAGTTCTCAGACATAA
GTATAACGAAAAATGTGATGTCTGGTCTTGTGGAGTTATTATGTATATTCTTTTGTGTGG
TTATCCTCCTTTCAATGCTGCTAGAGATGAAGATATTATGAAAAAAGTTGAAAAAGGAGT
TTTCACATTCCCTAAAGATGACTGGAAAGATATCACAATAGAGGTAAAAAACATTATAAA
AATTTACTAAAAACATAAATAAATAAAGAAATAAACATAAAATTACTAATAAACTCGAAC
CATAATAGAAGAGAGAGAAAACAACTTACTGATTTATTTTTTATACAAAAACAAACAACA
AAAGTTATAGATTTAAAACATAACCAAATAACTTGTTTAATTTATTAAGTATGAAGATAC
TTTAAAAAATTAATTACATTAATTTATTAGTTAACATTTCAATCAATAGTTTAAAATGAA
TAAAAAAATAAATAAATAACGAAAAAAAAAGAAATGCTACTGATTATTCATTCCAATTTA
CATTATTTATTTATTTATTTTTCATTTAAAGATTTTAAACTAATTTTTTATAAAAAGGCT
CAGCAAATGATTTGCAAAATGCTTACTATGGACCCCTAAAAGAGATATTCTGCTGAAGAA
GCTCTTTAGGATCCATGGATTAAGAAGTTTAGATAATAATAATAGGTAGATATGCCCAAC
TTAATTAGATCTTTGAATAATATGAAAACATTCAGAGCTGGTAAGAAATTACAAGAAGCT
GTATGGATGTTTATCGTTAACTATTTAGCTACTAAAGAAGAAAAGAATGAACTATTGAAA
ACTTTCTAGTCTTTAGATACCAACGGAGATGGTAAACTAAGTAGAGAAGAACTCATTAAT
GGTTATTCTAAAATCCTAACCATGGAAAATGCCATCAAGGAAGTAGATAAAATTATGAAA
GTTATAGATAAAAACGATAATGGTGATATAGATTATTCTGAATGGGTTGCTGCTACTATT
TCTCGTGAGTAGCTGTTGTCTGTATAAAGATTGGAAATGGCCTTTAATATTTTTGATAAG
GATGGTAGTGGTTCACTCTAGTTAAGTGAATTTAAAGAAATCTTTGGAGGAGCAGGAGTT
TCTGAAGATGTATGGAAGGCTGTCATCAAAGAGGTAGATAAAAATGGAGATGGTGAGATT
TCCTATCAAGAATTCAAAGAGATGATGCTTAAATACATTAAGGATGAAGAGTGA