Identifiers and Description

Gene Model Identifier

TTHERM_00500790

Standard Name

None

Aliases

PreTt08023 | 63.m00201 | 3716.m00054

Description

Accumulation-associated protein; Leucine Rich Repeat family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00560 ) Leucine Rich Repeat
  • ( PF09266 ) Viral DNA topoisomerase I, N-terminal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00500790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_2030
Tetrahymena borealisEI9_09653.19.997093137033517e-262leucine rich repeat family pro
tein (913 aa)
OxytrichaContig12775.0.g449.997093137033517e-262Leucine Rich repeats (2 copies
)
WormBaseWBGene001899522.0009605191578312e-25status:Partially_confirmed U
niProt:C4ALD3 protein_id:CCD
72863.1
DictyBaseDDB_G02840390.000000000000001999258566166494pprA on chromosome: 4 position
1595576 to 1596770
SGDYKL193C0.00000000002000577768187062SDS22 Conserved nuclear regula
tory subunit of Glc7p type 1 p
rotein serine-threonine phosph
atase (PP1), functions positiv
ely with Glc7p to promote deph
osphorylation of nuclear subst
rates required for chromosome
transmission during mitosis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00500790(coding)
ATGGATAATAAATAGCCTTCTGAGCCTCTATCTCCGCTCAAAAAAAAATAGTAGAATTCA
GAAAATCAAAAGAGACTAGATTTAATAAAAACTATGAATGGGTTTAGCGATAAGATTATG
AATAATCCAGGAAAGGTTGAATCAGTTGAATTAGTATTAGAAGAATTAGATAGGATGAAT
TGCATTTCACATTTTAAAAATCTTAAAACCTTAACATTAATTAATGTGAACCTTTATTAA
ATTGAAGGATTAGAAGAATTGCAATTATTAGAAAATTTGTGGCTTGACGAGAACCATATT
TCAAAAATAGATGGACTTTAGAATAATGTCAATTTGGTTAGACTTCATTTATCTAACAAT
AATATAAAATAGATATAAGGTTTAGATAATCTTGTAAATTTAGAGATATTATGGCTTTGT
AATAATAGAATAGATTCTTTGCAAAATTTACAATCTCTAGAAAAGCTAAAACAGTTATGG
ATTGCAGGAAATCAAATTGAAGAAATCAGAATATCTTTAGATAAATTGCAAAATTTGAAT
GACTTGAATATATCAGGAAATAAAATATGTTCTTTCAAGGAAGCATTAAATTTAAATAGA
TTGCCTAATTTAAAAATTTTAAGCTTTTACGATCCTCATTTTGGAGAGAATCCAATATGT
AATCTCTGTAACTATTAGACTTATGTTCTTTATCATCTAAGAAACATTACAAAGCTTGAT
ACTTTGTTTATATCTGATGAAGCAAAGAGCTTTGCTGAAGCAACCTTCATGAAAAAAAAA
ATGTATTATAATATGCGTATTAAAACAATGTAGAGAAGCTTTTCTACTCTAGGAAAACTT
ATTCGTAAAGCAAGAAAAATTAAGCTTGACTCTCTTAATGAAGATATTGCAAATCTTTAA
TTAAAAATTAACTAAATGTAAAGTTTAAATTCTAAAGGGTCTGAATTTTAAGATTACAAA
ACAATGTATACAGATAAAATTGAAGAAATTACTCATGTCGAGGAAGTATACGAGTCAATG
AAAAAAAAATTATACGAAAATTCTTCAATTTGTATTCATAAACTTATTACAGAGCTCGAA
ACTGGTGGAAATATCAGATTGGAAGAAGGTAAAAGTAATGAAAAGTGGTATATTAGTTGT
GAGGATTTGATAAAATCAAGATTCCACAAGGAAGACATGATTGGGTATGGAATTTAGGAT
TTACAAATAAAAAGAGTTGTGAGAATTCATAATAGATTCCTCAGAAATAAGTTTGAAGAA
AAAATGGAAAGTTTAGTTGATGTTAGCAACTCAAACTACAAAAAGAGTTTGGAGTACTTA
TTTTATGGAGTAGATCCAAATACTCCATAGGAGATATACCACGTTTTAGAAGAGGGCTTT
CGTCCTTATAATGAATGCAAGCAATTAGGTTTATGTGGATACACACCACTTGTAAATAGT
ATACTAGGTGCCGATAGTGCTCGTCTAATGAGTTTCCTTAAGAATAAGCGTAATCACGAA
AAATTCAAAAAAGCATTCATTAAACGTCGCTTTTAAGATAGTCTTACCATATATCCTCCT
GGAATGCTATTGATTTGCAAAGTTTTAATGATTAAAAGTGTTTCTGATAATAAAACTCCA
TTTTTTGACCCAGATGTTGCTCCAAGCGATATTTTTAGAAATGCTCCTATTGATTCTAAA
CTTTTTTCTGAAGAAAATACTATCTATAGAGTAAAAGAAAACGACCCAAAGCATAAGTTA
TGGTTTGTGATCGATAACAATCTTGTATTGCCAGAGTATCTTGTAGAGTTCAATTATATT
CTTGCAAATGAAAATTAAAATAAGATTTCTGATTTTGGAGATCAAATAGGTATCCTAGAT
AATCCTGAAGATGAATTTATTTCTCCTAAAAACATTCATATTTACAAAGGAGAATTAAAT
AATATATATAATACACTCTGTGAAGAGATAAATAATTACCAATTTGAAAATATAGAAGAC
TTAAAACATCCTAATTTGGAAATAAAAGCTTAAGATCTAGATAGAGCAGATATATCATTA
ATAAAGATAACTTTACTGAATTATTTTAAATATTGTCTTTCAAGATCTTTCTTATACGAA
CTTAACCCTAACTTATTATAGGAAGCAGTCGAATAAGAAATTACTTAGGATATGGTTCTT
GAACAATATCAAAAAAATCCTGAAGAAATTCTATTCGTTAACTTATCTAACATGAAAATA
AGTGAAATATGCATTTTCCCACAACTGAAAAATCTTTAAACTCTCATCCTTTCATATAAT
AAAATACTTGAGATCAAAAACTTAGATTACTACCCTCATCTCTCAACTTTAGATTTAAAT
CATAATTAAATTACTTCATTGAGTGGACTTAGTAGCTTAGAAAAATTAGAAATATTTGAT
GTTTCTCATAACGATATTGCTGATATCAAAGAAATTACATAGCTTTAAAGCAACATCAAT
TTGGTAGATTTAAAGGTTATATTTAATCCATTTAGTGAGAAAAAAGATATTGTGAACGAT
ATCGTTTAAATACTTCCTTAACTTGTTTACTTAGATAACAAATTAATTAATAAGGAGAGT
ATATAAAGAAATAAAGAAAAGATTATAACAGAAATAAGTGATGATATGATAAAAGAATAT
GGAAAGATTATACAAAGCAGATCGTTATCTTAACTCGAACCAAACTGGAAAGAAACTATA
GAAATAATAAACTTATCTCATTTGAAATTAAGAGGAATAAAAGGTTTAGATTAACTGGTT
AATTTGAGATAAGCAAATTTTAGTCATAATCTCATTGAAAAAATAGAAGGTTTGAGTAAC
TGCAAGCTTTTAGAAGAATTAAGCTTCGAAAAAAATAAAATTACTAAAATTACTGGGTTA
GAAAACTTAATTTATCTCAAAAAAATGGAGCTTGGAAAGAATAAAATCAATTAAATTTCA
GGATTAGCTCATCTCTCAAATTTAATGCAACTATCGTTGGAAGACAATATGATAGAATCT
TTAGAGGATTTCCCTGAATTAAAAAATTTGATGGAATTATATTTAGGTAATAACTCAATA
ACTGAGTCTAAAGAAATTACTAATCTTAAAGGATTGCAAAAGTTAATTATATTAGATTTA
TCTGGAAACCCTTTCTCCAGAGACCCCAATTATCGTATATACACTCTATTCATTATCAAA
AAGCTTAAGGTCCTTGATGGTATATCAATAGAAGCTAGTGAGTAATAGCTTGCAAAAGAT
TTGTTTACTGGTAGGTTGACAGAAGAAATATTAATGTCTCGTTTGTATGGATAATCAGCT
TAGGAAATAACTGAGTTAGATCTTTCCAACTGCAAATTAAGAGATTTTGATGAAGTATTT
ACTCATCATAGCTTCCCTAATTTAACAGAGCTTAATTTATCTGCAAACCTATTTTAATCA
ACTCGTATGCTTGGATATCTGCCTAATTTGAAAATACTTATTTTAAATTCTAATAAAATT
GAGACTCTAGCCTCTGTAACAGATGCTAATGTAAAAAAAGCTCTGAATGGTTGTTAAAAT
TTAGAAATCTTAGATATAAGTAATAACAACCTTAAAGAGTTTCATGGTTTGTAATTTTGT
TTGCTCAGAGAGTTGAAGATATTAAAGGCATATAGAAATGAAATTTATAAAATAGATTGC
CTTGAGCAATTAAAGTCACTTCGTGAATTAGATGTAAATCATAATAAAGTTCGTCAATTT
GATCCAATGTCGTTTATAGGATCTAATCCGATCAAATGCTTGAAGATAGATGATAACGGT
CTTAAAAATTTTAACAATATATAAAGACTTTATAAGTTGTAGCATCTTTTTGCTAATTCA
AATAGAATCAATGATATTCCTGACATTGAAAAATTATCAGAATTGACATATTTAAAAGAA
CTTGAATTAAATGGTAATGCCTTTTCTAGAAGACCTGGATATAGAGCTGCTGTCTTAAAG
AAACTACCTACTTTACTTTATCTAGATGGAAGAGAGGTAACAATAGAAGAAAGAGAGAGA
TTAGATGGAATCCCTTAGTAAATAGATAAAGGATAAAATCTACCAAATATTCATATGCCT
TCTATGAATAATTAAAAAGGATTTGTTTAAGTTAAATTGAATTCTATAAACTTTGATGGA
GTATTTAGTAAAAAATTAAATCAAGCAAATTGGCCAAACTAGTAGTAATTTTGA


>TTHERM_00500790(protein)
MDNKQPSEPLSPLKKKQQNSENQKRLDLIKTMNGFSDKIMNNPGKVESVELVLEELDRMN
CISHFKNLKTLTLINVNLYQIEGLEELQLLENLWLDENHISKIDGLQNNVNLVRLHLSNN
NIKQIQGLDNLVNLEILWLCNNRIDSLQNLQSLEKLKQLWIAGNQIEEIRISLDKLQNLN
DLNISGNKICSFKEALNLNRLPNLKILSFYDPHFGENPICNLCNYQTYVLYHLRNITKLD
TLFISDEAKSFAEATFMKKKMYYNMRIKTMQRSFSTLGKLIRKARKIKLDSLNEDIANLQ
LKINQMQSLNSKGSEFQDYKTMYTDKIEEITHVEEVYESMKKKLYENSSICIHKLITELE
TGGNIRLEEGKSNEKWYISCEDLIKSRFHKEDMIGYGIQDLQIKRVVRIHNRFLRNKFEE
KMESLVDVSNSNYKKSLEYLFYGVDPNTPQEIYHVLEEGFRPYNECKQLGLCGYTPLVNS
ILGADSARLMSFLKNKRNHEKFKKAFIKRRFQDSLTIYPPGMLLICKVLMIKSVSDNKTP
FFDPDVAPSDIFRNAPIDSKLFSEENTIYRVKENDPKHKLWFVIDNNLVLPEYLVEFNYI
LANENQNKISDFGDQIGILDNPEDEFISPKNIHIYKGELNNIYNTLCEEINNYQFENIED
LKHPNLEIKAQDLDRADISLIKITLLNYFKYCLSRSFLYELNPNLLQEAVEQEITQDMVL
EQYQKNPEEILFVNLSNMKISEICIFPQLKNLQTLILSYNKILEIKNLDYYPHLSTLDLN
HNQITSLSGLSSLEKLEIFDVSHNDIADIKEITQLQSNINLVDLKVIFNPFSEKKDIVND
IVQILPQLVYLDNKLINKESIQRNKEKIITEISDDMIKEYGKIIQSRSLSQLEPNWKETI
EIINLSHLKLRGIKGLDQLVNLRQANFSHNLIEKIEGLSNCKLLEELSFEKNKITKITGL
ENLIYLKKMELGKNKINQISGLAHLSNLMQLSLEDNMIESLEDFPELKNLMELYLGNNSI
TESKEITNLKGLQKLIILDLSGNPFSRDPNYRIYTLFIIKKLKVLDGISIEASEQQLAKD
LFTGRLTEEILMSRLYGQSAQEITELDLSNCKLRDFDEVFTHHSFPNLTELNLSANLFQS
TRMLGYLPNLKILILNSNKIETLASVTDANVKKALNGCQNLEILDISNNNLKEFHGLQFC
LLRELKILKAYRNEIYKIDCLEQLKSLRELDVNHNKVRQFDPMSFIGSNPIKCLKIDDNG
LKNFNNIQRLYKLQHLFANSNRINDIPDIEKLSELTYLKELELNGNAFSRRPGYRAAVLK
KLPTLLYLDGREVTIEERERLDGIPQQIDKGQNLPNIHMPSMNNQKGFVQVKLNSINFDG
VFSKKLNQANWPNQQQF


>TTHERM_00500790(gene)
ATGGATAATAAATAGCCTTCTGAGCCTCTATCTCCGCTCAAAAAAAAATAGTAGAATTCA
GAAAATCAAAAGAGACTAGATTTAATAGTAATAAATTAGCATTTTTAAATGAATTTTTTC
AATTTATTTTAGATTTATTTTAAGAAATTAATATAAAATTGCTAATTATTGTAAAGACAT
TTTTATTTGCATTTAAATTAGAAAACTATGAATGGGTTTAGCGATAAGATTATGAATAAT
CCAGGAAAGGTTGAATCAGTTGAATTAGTATTAGAAGAATTAGATAGGATGAATTGCATT
TCACATTTTAAAAATCTTAAAACCTTAACATTAATTAATGTGAACCTTTATTAAATTGAA
GTAAAAAATATATCTTAAAATATAAAGCGAATTCAATTTCAGTAAGCTATTTACTATGAT
TCTAATTTTCTTTTTTCTATGTATTTAGGGATTAGAAGAATTGCAATTATTAGAAAATTT
GTGGCTTGACGAGAACCATATTTCAAAAATAGATGGACTTTAGAATAATGTCAATTTGGT
TAGACTTCATTTATCTAACAATAATATAAAATAGATATAAGGTTTAGATAATCTTGTAAA
TTTAGAGATATTATGGCTTTGTAATAATAGAATAGATGTAATTCATTATATCAATTAGAT
TCATTAAAATAAATTTGAAATTATTCAAAAAAATAAAATATTATCATATTTGCAATTTCA
ATTTTGGTTATAAATAAAATAAATCATCATAAATGTATATAATAAAACTAGTCTTTGCAA
AATTTACAATCTCTAGAAAAGCTAAAACAGTTATGGATTGCAGGAAATCAAATTGAAGAA
ATCAGAATATCTTTAGATAAATTGCAAAATTTGAATGACTTGAATATATCAGGAAATAAA
ATATGTTCTTTCAAGGAAGCATTAAATTTAAATAGATTGCCTAATTTAAAAATTTTAAGC
TTTTACGATCCTCATTTTGGAGAGAATCCAATATGTAATCTCTGTAACTATTAGGTATAT
TTATTATAAATACTTGCTTCATTATATATCTAATTAACTAAACTAAATTATTTTTTGATA
ATCTATTTAGACTTATGTTCTTTATCATCTAAGAAACATTACAAAGCTTGATACTTTGTT
TATATCTGATGAAGCAAAGAGCTTTGCTGAAGCAACCTTCATGAAAAAAAAAATGTATTA
TAATATGCGTATTAAAACAATGTAGAGAAGCTTTTCTACTCTAGGAAAACTTATTCGTAA
AGCAAGAAAAATTAAGCTTGACTCTCTTAATGAAGATATTGCAAATCTTTAATTAAAAAT
TAACTAAATGTAAAGTTTAAATTCTAAAGGGTCTGAATTTTAAGATTACAAAACAATGTA
TACAGATAAAATTGAAGAAATTACTCATGTCGAGGAAGTATACGAGTCAATGAAAAAAAA
ATTATACGAAAATTCTTCAATTTGTATTCATAAACTTATTACAGAGCTCGAAACTGGTGG
AAATATCAGGTATTCCAATAACTTACTTTCTTTATGAGATTAACAAATTATTTAAATTAT
TTTTTAACATAAAGATTGGAAGAAGGTAAAAGTAATGAAAAGTGGTATATTAGTTGTGAG
GATTTGATAAAATCAAGATTCCACAAGGAAGACATGATTGGGTATGGAATTTAGGATTTA
CAAATAAAAAGAGTTGTGAGAATTCATAATAGATTCCTCAGAAATAAGTTTGAAGAAAAA
ATGGAAAGTTTAGTTGATGTTAGCAACTCAAACTACAAAAAGAGTTTGGAGTACTTATTT
TATGGAGTAGATCCAAATACTCCATAGGAGATATACCACGTTTTAGAAGAGGGCTTTCGT
CCTTATAATGAATGCAAGCAATTAGGTTTATGTGGATACACACCACTTGTAAATAGTATA
CTAGGTGCCGATAGTGCTCGTCTAATGAGTTTCCTTAAGAATAAGCGTAATCACGAAAAA
TTCAAAAAAGCATTCATTAAACGTCGCTTTTAAGATAGTCTTACCATATATCCTCCTGGA
ATGCTATTGATTTGCAAAGTTTTAATGATTAAAAGTGTTTCTGATAATAAAACTCCATTT
TTTGACCCAGATGTTGCTCCAAGCGATATTTTTAGAAATGCTCCTATTGATTCTAAACTT
TTTTCTGAAGAAAATACTATCTATAGAGTAAAAGAAAACGACCCAAAGCATAAGTTATGG
TTTGTGATCGATAACAATCTTGTATTGCCAGAGTATCTTGTAGAGTTCAATTATATTCTT
GCAAATGAAAATTAAAATAAGATTTCTGATTTTGGAGATCAAATAGGTATCCTAGATAAT
CCTGAAGATGAATTTATTTCTCCTAAAAACATTCATATTTACAAAGGAGAATTAAATAAT
ATATATAATACACTCTGTGAAGAGATAAATAATTACCAATTTGAAAATATAGAAGACTTA
AAACATCCTAATTTGGAAATAAAAGCTTAAGATCTAGATAGAGCAGATATATCATTAATA
AAGATAACTTTACTGAATTATTTTAAATATTGTCTTTCAAGATCTTTCTTATACGAACTT
AACCCTAACTTATTATAGGAAGCAGTCGAATAAGAAATTACTTAGGATGTAAATTATTTT
TTTATTTTATCATTGATTTATTTTTTTTCATATTATTTAAGATGGTTCTTGAACAATATC
AAAAAAATCCTGAAGAAATTCTATTCGTTAACTTATCTAACATGAAAATAAGTGAAATAT
GCATTTTCCCACAACTGAAAAATCTTTAAACTCTCATCCTTTCATATAATAAAATACTTG
AGATCAAAAACTTAGATTACTACCCTCATCTCTCAACTTTAGATTTAAATCATAATTAAA
TTACTTCATTGAGTGGACTTAGTAGCTTAGAAAAATTAGAAATATTTGATGTTTCTCATA
ACGATATTGCTGATATCAAAGAAATTACATAGCTTTAAAGCAACATCAATTTGGTAGATT
TAAAGGTTATATTTAATCCATTTAGTGAGAAAAAAGATATTGTGAACGATATCGTTTAAA
TACTTCCTTAACTTGTTTACTTAGATAACAAATTAATTAAGTAATATAATTTCACTATTC
AGCAATTTTTTCTTTAAAAAAAGAAGAATCCAATTAAGATTTTGAATTTTATAATAATTT
ATTTTCACGATATAAAAATCATTAAACTTAAATTTTTAGAAAATTAAAAATTCTTTTAAT
TAACAAAAATTTTCAAAGCTAAATTAAATTAAACCTTATTTGTATATGTTTATAGTAAGG
AGAGTATATAAAGAAATAAAGAAAAGATTATAACAGAAATAAGTGATGATATGATAAAAG
AATATGGAAAGATTATACAAAGCAGATCGTTATCTTAACTCGAACCAAACTGGAAAGAAA
CTATAGAAATAATAAACTTATCTCATTTGAAATTAAGAGGAATAAAAGGTTTAGATTAAC
TGGTTAATTTGAGATAAGCAAATTTTAGTCATAATCTCATTGAAAAAATAGAAGGTTTGA
GTAACTGCAAGCTTTTAGAAGAATTAAGCTTCGAAAAAAATAAAATTACTAAAATTACTG
GGTTAGAAAACTTAATTTATCTCAAAAAAATGGAGCTTGGAAAGAATAAAATCAATTAAA
TTTCAGGATTAGGTATTTTTTTATTTATTGAGCTTTAAAATTTATTTCATTTTTGTTAAA
TTTCATTAATAGAATCTAATATTTTATTTTATTTAACTAAAAATATTAGCTCATCTCTCA
AATTTAATGCAACTATCGTTGGAAGACAATATGATAGAATCTTTAGAGGATTTCCCTGAA
TTAAAAAATTTGATGGAATTATATTTAGGTAATAACTCAATAACTGAGTCTAAAGAAATT
ACTAATCTTAAAGGATTGCAAAAGTTAATTATATTAGATTTATCTGGAAACCCTTTCTCC
AGAGACCCCAATTATCGTATATACACTCTATTCATTATCAAAAAGCTTAAGGTAAACAAG
CACTTTACACATTTATTTTATTAAGAAACAATTTTTTTATTAGGTCCTTGATGGTATATC
AATAGAAGCTAGTGAGTAATAGCTTGCAAAAGATTTGTTTACTGGTAGGTTGACAGAAGA
AATATTAATGTCTCGTTTGTATGGATAATCAGCTTAGGAAATAACTGAGTTAGATCTTTC
CAACTGCAAATTAAGAGATTTTGATGAAGTATTTACTCATCATAGCTTCCCTAATTTAAC
AGAGCTTAATTTATCTGCAAACCTATTTTAATCAACTCGTATGCTTGGATATCTGCCTAA
TTTGAAAATACTTATTTTAAATTCTAATAAAATTGAGACTCTAGCCTCTGTAACAGATGC
TAATGTAAAAAAAGCTCTGAATGGTTGTTAAGTAAATAATCAACAAATTTTAAATTAATG
AAAATTTATTTTTAAAATTTATAGAATTTAGAAATCTTAGATATAAGTAATAACAACCTT
AAAGAGTTTCATGGTTTGTAATTTTGTTTGCTCAGAGAGTTGAAGATATTAAAGGCATAT
AGAAATGAAATTTATAAAATAGATTGCCTTGAGCAATTAAAGTCACTTCGTGAATTAGAT
GTAAATCATAATAAAGTTCGTCAATTTGATCCGTAATTTTGATACATTTAATGCCTTTAT
TTAATAATTTTTATAAAATTAAAAATAAGAATGTCGTTTATAGGATCTAATCCGATCAAA
TGCTTGAAGATAGATGATAACGGTCTTAAAAATTTTAACAATATATAAAGACTTTATAAG
TTGTAGCATCTTTTTGCTAATTCAAATAGAATCAATGATATTCCTGACATTGAAAAATTA
TCAGAATTGACATATTTAAAAGAACTTGAATTAAATGGTAATGCCTTTTCTAGAAGACCT
GGATATAGAGCTGCTGTCTTAAAGAAACTACCTACTTTACTTTATCTAGATGGAAGAGTA
TTTTAATATTTTGTTTTAAATGTAAATAATTAAGTTTTTTTATTACATGTAATAAAAATT
AGGAGGTAACAATAGAAGAAAGAGAGAGATTAGATGGAATCCCTTAGTAAATAGATAAAG
GATAAAATCTACCAAATATTCATATGCCTTCTATGAATAATTAAAAAGGATTTGTAAGCT
AAATTTTAATTTATTAAAAATGCTAAAAAAATATTTTCAATAAACAAACAGGTTTAAGTT
AAATTGAATTCTATAAACTTTGATGGAGTATTTAGTAAAAAATTAAATCAAGCAAATTGG
CCAAACTAGTAGTAATTTTGA