Identifiers and Description

Gene Model Identifier

TTHERM_00497790

Standard Name

None

Aliases

PreTt06944 | 62.m00228 | 3715.m00089

Description

S-antigen protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07620 ) SLEI
  • ( PF02370 ) M protein repeat
  • ( PF00904 ) Involucrin repeat
  • ( PF05756 ) S-antigen protein
  • ( TIGR01612 ) rhoptry protein
  • ( PF04428 ) Choline kinase N terminus
  • ( PF08017 ) Fibrinogen binding protein
  • ( TIGR02641 ) gas vesicle protein GvpC repeat
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF05890 ) Eukaryotic rRNA processing protein EBP2

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00497790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12696.19.997093137033517e-262hypothetical protein (1512 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00497790(coding)
ATGAGCTCAATTCAAGGAGGACGATAGACTTAAGAAAACACTCTACCAAATAAAACAAAA
TTAATAAAGAGAAATGTAAATTCACAGTTGCTTAAAGATAAAATGGCATACTTTGACATA
AAAACACCAAATATAAAATTTGCATCATTATTTGAGGAGACTACAGAACTCTTAAATGAA
ATCATTAAAAATCCAAATATTCAAAATGAAGTGCTAAGTTAGAATCTTTAAGAAATAGAA
AAAAAGATTAAAGCTATGAATTAAGAAAGAAGTAGAGTGTAAAAAGAGTTAAGTGAGTTT
GCTTTTGGACACATTTTGCATATGATTGATATTTACTAATATTCAGAGGATTTAAATCAT
AAATATATTTCATTCTATTTAATGAAAGTTTGGATTAAAAATTTCTAATATTCTGAACAA
TATATTGATGCAATGCTGGCAAGTATAGATGACAATTTATCTTTTCAAAAAGAAATTTTC
TCTTTCTTGTAAGAATTAAGTATTGAAAAACCAGATGTTTTGGATAAGATTTTAAAAATG
GCCAATTCAATCACTAATTGTTTTTAAGGATTAATAGCTTCAGATTAAGAAGAAAATTAA
TAAGAAAAAAAGAATGTTTCTGGATTTACAAAAGGAAAGAGTTAAGAAGAATTCTTAGAG
TTTGTACTTAATATTTTGTAAAAGTTTGATAGTCAAGAACTTGAAAAGCAGCTAATTAAC
ATTATCTAAAAATATGTTCCTTAAAATAACATATAATATCACAAAATAATTCTAGAAAAT
TTTTTGAGCAATGAAGAAATTTACGAAAAATATTTTTATATTTGCATTGAACTAATTAAA
AAGGGATTTGATGATTAAGATGTTTAAATTGTATCTTAGTATATCAAAAAAGCTGAAACT
TTTTATTTGAAAATAAAAAATTCAAATAGAAGGGGAGAATTCATTAAACTGTTAATCAGC
AATCTTCTTTTCCTTCGTTAAGTCAAAAAGTAAGAAATAAGTAAGCCTATAAGAAATTTA
TGGAAGCCTACTATTTTTAGTGATCAAGAAGGTTAAGAGAAAATCTTAGAACATTAAGAA
GAAATTATTTCTTTTCTTTGCAGTAAATTTACAACTGGAGAAGAAGAAACAATTACAATG
GCGACTGATGGGCTATTAGAAATTATTGATAAAGTAATTAAAGACTCTACTAACCTTTAA
AGTGCACCGAATAATAAAAAGGTTAACTATTTTTAACAGATATTGAATGGATGTTTAAAT
AATATGTAAAACTAAGAAAAGTACTTCTAACTTTTGACTAAATTTACAGATGTTATTGGC
ATGAAATTAACACTATAAATACAAGCATTAGTTCGTTTAGAATGGAAAAGTGTAGCCAAT
ATAGATATAAATAGTATTTATAATTATTATTAAAAGCAGTAAATAGATCTAAGAACTGAA
CTGTTAAAGTTCAGATAATTTATTGCAGCATATTTCTATTTGTTTATTTTAAATAAAAAA
ATCATGTCTAAAGATATTGAGTAAGAGTTTTATCAAGTTGATAATAGCAATATCGGTATT
AAAAAAATGAATCTTAATATTATCCATGGTTTTTTGTCTTAATTCGCTGAAATTCCTTAA
TCTAAGGCCATATTAGAAGCTAATCTTCCTCACTATTTCAAATTAGAAAGGATTTCTTAA
CTAAAAGAATTAGAAAAGTATTATGGATAAGATTACATCAAGAATTTGATAAACTCATAT
AAAGGAGAACATTAAGCATATGTAAGCTATTAAATATACCTTTAATAAACTTCTACACTT
TAAAATAGTAAACAAAATAATTAGTAATAATAATAATAATAATAAAACAACAACAAAATT
CTTACTGTTAAAGAATATGCCTATGTAACATTTGATTAAAAAAGATAAATGTTTTCTCAC
CTAAATATTCCTACTGCTTCATAAGCACCATTAAATGAAATTGCAAAAATAGATTCAATG
GAAATAGAAGAATAAGCTAAATAAAATAAAATTTAAGAAAAACATAAACCAACTCATGAA
AGTAATATTAATAAAAATAAATAAGTTAGCGGTTAAAAATCACACCATTAAAATTAAGAG
AATATTCACTAAAAAAATTAATTAAAGACTAATTAAGTGCAAAATCCAAATTCTTAAGCT
TAATCAAAGGCACACCATAATAAAAATGTATAGAAAGTTAATAATCCAAATAAATAAACA
TAAGATTAATTAGGGTAAAAAGATTAGCAAAATAAGGAATAATAGTAAATGATGAAGGAA
TAAACTAAAGAAAACTTATAAGTTTAAGAAGAACCATAGCAAGTTTAAGAAAAACCGTAG
CAAATGTAAGAAGAATCATAGAATCTTTAAGAAGAGTCATAGCAAATTTAAGAAGAGTCA
TAGCAAGTTTAAGAAGAGTCATAGTAAGTTTAAGAAGAGTCATAACAAATTTAAGAAGAA
TCAAAGCAAATTTAAGAACAACAATTGCTAATTTAAGAAGAATAGTCTTAACAAGTTTAA
GAATAAATGTAAATTGAGAATACAGAAAGCAATAAAAACGAATCTGAAATTGAATAATAA
AAAAATTTAGTAAAAGAAAACGAATCTTAATCCTAAATAGATATCTAAAAACAATAGAAA
TCACAAATTGACTTAAAGTAATAGGATTAGCAATCAATACCAGCCAAATAAAAAGATGAA
ATTAAAATTAAATCATCCTAAATTTTAGAACCAAATAATAAAGAAAGTCATTAAATTGAA
GCTTAAGAAGAAAAATAATAGACTTAATAAGGTTCAATTATTCAGGAAACTGTTCAAAAA
TCAGAAAAAATGGATATTGAAGAAAATAAGCAAGAAGAATAGAGTAAATAAGAAAGCTAA
ATAGTTTAAACAAAAGATTAAAGTTCTTCTTAAAATACAATCCCTTAAAAGGCATAATTA
CCTGTTTTATCTATCAAAAAACCTAATATTTAATAAAATCTCTCTCAAGCTAACTAATAA
TCAACAACTTAAACTAACCTAGTTGCATAAAAATAACCACAAAATATCACCTAAGTACCC
ACACAAGAACCAAAGGATAAAATAAATATCGATTAAAATAATGAGAAATCGTCATAAGCT
TTAAATTAGGTAAAACCTAAACTAAGCATTAAAGAAAAGGCGTTATTGATGATGAAAAAT
AAATAAGATGGTGCAAAGTAAAATAATACATAAACTCCTTCTACAGAGTAGATATAATAA
CAAAATGAAATTTAAACAGAAAAACCTTAAGAAAACATTCCTAAGCCTGCTATAAGTTTT
CCTACTTTAGAATTAAAATAATAATAGCAATAAAAGCAAATAGATTAAAAAGCTAAAAAT
TCTGAATCTCCTGAGAAACAGCCATCTGAAAATAAGCCTTCAATAGATTTAACTAAAAAG
CCTTCTCTTTTGATGATGAAAAAGAAATAAGAATAACAGACTCCTTCTACCCCAATTAAT
TAAAATGTTAATACTGAAAAAATGGAAATAGAATAAAACTAACCTTAACAAACACTTGAG
ACCTCTTAAAATACTGAAAAAACCTAATAAAAACCTGCACTATCATTAAAACCAAAAATT
TAAATCAAAAGCTAAGAGAAGCAATAAACAGAGCAAACACTACAAAAAGTAGAAGAAAAT
TTAAAATAAGTAGATAAACCTGAAGAAGGTGAAGTAAAAGATTTACAAGTAACCGAAAAT
AAAAAAACTTAATAGATATCACAAGTTAGTATTGATGAAAAACAAAGCTAAGATCCTTTA
AATTAAAATATTAGTGATATATAAAATAATATTGAAACTTCAAATGATACAAATGCAGCT
GAGTAAAATATAACCGAAAATATAATAGAAAATAATTTACAGACATAAGAGTAAGTTAAG
AGTAAGGAGGATAATTCGTTAAATGTAGATAATGATTAAGAAAAAATATTAGAAAATAAT
CCTGATATTAAAAACGAAAATAGCACAGATTAGCTAGAAGAAAAACAGACCTTAGAAGTT
GAGTAAGAAGCTTAATAAGTTGAAAGTGAACAACTAAATGAAAATTTATAAGAATAAAAA
TAGGAGGAAGATTAAATAGTTTAAAATACTTAAACAGATTAAGAAATATAAAAATTAAAT
GAAGAGGAAATTTAATAAAATTAAGCAGAATTAAATGAAATCGAAATAGAAAATTAAAAT
GAAGAAAATGATTTAAATAACAAAATTGTTTAAGATGAGAATTTAGAAGCAGATGCTAAT
GAGGGATTATTGTAGAATTAAGAATAAATTTAAGATGCTTTAAATATAATAGAAGAGGAA
GATCAGCAACTAACAATAAGCTAAACTAATCAAGATGAATTAATATAAGAGGAAGCAGAG
GATTTTTAGGCAAATGAAGAATAAGTAGATGAAGCCACTTTAGGATTAGCTCTAAAAACT
TAGCAAGAGGAATAATTAAATTAATAAGAAAACGAATAAGAAAATGAGCAATAATTAAAT
TAATAGGAAAATGAATAAGAAAATGAGCAATAATTAGAATAATAGACTAATGAGTAAGAA
TAAGATCAAGGATTTACAGATTAGCAAGAAGAAAACGAATAAAAAAATTTAGAATAAATA
AATGAAGAGAATAAGGAATCCAACGAAGATAAAGTAGAAGAATAAAATTGA


>TTHERM_00497790(protein)
MSSIQGGRQTQENTLPNKTKLIKRNVNSQLLKDKMAYFDIKTPNIKFASLFEETTELLNE
IIKNPNIQNEVLSQNLQEIEKKIKAMNQERSRVQKELSEFAFGHILHMIDIYQYSEDLNH
KYISFYLMKVWIKNFQYSEQYIDAMLASIDDNLSFQKEIFSFLQELSIEKPDVLDKILKM
ANSITNCFQGLIASDQEENQQEKKNVSGFTKGKSQEEFLEFVLNILQKFDSQELEKQLIN
IIQKYVPQNNIQYHKIILENFLSNEEIYEKYFYICIELIKKGFDDQDVQIVSQYIKKAET
FYLKIKNSNRRGEFIKLLISNLLFLRQVKKQEISKPIRNLWKPTIFSDQEGQEKILEHQE
EIISFLCSKFTTGEEETITMATDGLLEIIDKVIKDSTNLQSAPNNKKVNYFQQILNGCLN
NMQNQEKYFQLLTKFTDVIGMKLTLQIQALVRLEWKSVANIDINSIYNYYQKQQIDLRTE
LLKFRQFIAAYFYLFILNKKIMSKDIEQEFYQVDNSNIGIKKMNLNIIHGFLSQFAEIPQ
SKAILEANLPHYFKLERISQLKELEKYYGQDYIKNLINSYKGEHQAYVSYQIYLQQTSTL
QNSKQNNQQQQQQQQNNNKILTVKEYAYVTFDQKRQMFSHLNIPTASQAPLNEIAKIDSM
EIEEQAKQNKIQEKHKPTHESNINKNKQVSGQKSHHQNQENIHQKNQLKTNQVQNPNSQA
QSKAHHNKNVQKVNNPNKQTQDQLGQKDQQNKEQQQMMKEQTKENLQVQEEPQQVQEKPQ
QMQEESQNLQEESQQIQEESQQVQEESQQVQEESQQIQEESKQIQEQQLLIQEEQSQQVQ
EQMQIENTESNKNESEIEQQKNLVKENESQSQIDIQKQQKSQIDLKQQDQQSIPAKQKDE
IKIKSSQILEPNNKESHQIEAQEEKQQTQQGSIIQETVQKSEKMDIEENKQEEQSKQESQ
IVQTKDQSSSQNTIPQKAQLPVLSIKKPNIQQNLSQANQQSTTQTNLVAQKQPQNITQVP
TQEPKDKINIDQNNEKSSQALNQVKPKLSIKEKALLMMKNKQDGAKQNNTQTPSTEQIQQ
QNEIQTEKPQENIPKPAISFPTLELKQQQQQKQIDQKAKNSESPEKQPSENKPSIDLTKK
PSLLMMKKKQEQQTPSTPINQNVNTEKMEIEQNQPQQTLETSQNTEKTQQKPALSLKPKI
QIKSQEKQQTEQTLQKVEENLKQVDKPEEGEVKDLQVTENKKTQQISQVSIDEKQSQDPL
NQNISDIQNNIETSNDTNAAEQNITENIIENNLQTQEQVKSKEDNSLNVDNDQEKILENN
PDIKNENSTDQLEEKQTLEVEQEAQQVESEQLNENLQEQKQEEDQIVQNTQTDQEIQKLN
EEEIQQNQAELNEIEIENQNEENDLNNKIVQDENLEADANEGLLQNQEQIQDALNIIEEE
DQQLTISQTNQDELIQEEAEDFQANEEQVDEATLGLALKTQQEEQLNQQENEQENEQQLN
QQENEQENEQQLEQQTNEQEQDQGFTDQQEENEQKNLEQINEENKESNEDKVEEQN


>TTHERM_00497790(gene)
ATGAGCTCAATTCAAGGAGGACGATAGACTTAAGAAAACACTCTACCAAATAAAACAAAA
TTAATAAAGAGAAATGTAAATTCACAGTTGCTTAAAGATAAAATGGCATACTTTGACATA
AAAACACCAAATATAAAATTTGCATCATTATTTGAGGAGACTACAGAACTCTTAAATGAA
ATCATTAAAAATCCAAATATTCAAAATGAAGTGCTAAGTTAGAATCTTTAAGAAATAGAA
AAAAAGATTAAAGCTATGAATTAAGAAAGAAGTAGAGTGTAAAAAGAGTTAAGTGAGTTT
GCTTTTGGACACATTTTGCATATGATTGATATTTACTAATATTCAGAGGATTTAAATCAT
AAATATATTTCATTCTATTTAATGAAAGTAAGTTATTTAAAAAATAAAATAGAATATATA
TTTATGAAAAACAAACACATTTTATTTTAGAGTTTTTTAGTTAAATTTGCTCAATTTTAA
ATATTCAACTTTATTTTTATTTACTATTAAGAATTTGGTTTTTATGTATAGGTTTGGATT
AAAAATTTCTAATATTCTGAACAATATATTGATGCAATGCTGGCAAGTATAGATGACAAT
TTATCTTTTCAAAAAGAAATTTTCTCTTTCTTGTAAGAATTAAGTATTGAAAAACCAGAT
GTTTTGGATAAGATTTTAAAAATGGCCAATTCAATCACTAATTGTTTTTAAGGATTAATA
GCTTCAGATTAAGAAGAAAATTAATAAGAAAAAAAGAATGTTTCTGGATTTACAAAAGGA
AAGAGTTAAGAAGAATTCTTAGAGTTTGTACTTAATATTTTGTAAAAGTTTGATAGTCAA
GAACTTGAAAAGCAGCTAATTAACATTATCTAAAAATATGTTCCTTAAAATAACATATAA
TATCACAAAATAATTCTAGAAAATTTTTTGAGCAATGAAGAAATTTACGAAAAATATTTT
TATATTTGCATTGAACTAATTAAAAAGGGTAGCTTATTTGATTTTAATTTTATTATTTAA
TTATAAATTGACATTTTATTAATTATTATAAAAAGGATTTGATGATTAAGATGTTTAAAT
TGTATCTTAGTATATCAAAAAAGCTGAAACTTTTTATTTGAAAATAAAAAATTCAAATAG
AAGGGGAGAATTCATTAAACTGTTAATCAGCAATCTTCTTTTCCTTCGTTAAGTCAAAAA
GTAAGAAATAAGTAAGCCTATAAGAAATTTATGGAAGCCTACTATTTTTAGTGATCAAGA
AGGTTAAGAGAAAATCTTAGAACATTAAGAAGAAATTATTTCTTTTCTTTGCAGTAAATT
TACAACTGGAGAAGAAGAAACAATTACAATGGCGACTGATGGGCTATTAGAAATTATTGA
TAAAGTAATTAAAGACTCTACTAACCTTTAAAGTGCACCGAATAATAAAAAGGTTAACTA
TTTTTAACAGATATTGAATGGATGTTTAAATAATATGTAAAACTAAGAAAAGTACTTCTA
ACTTTTGACTAAATTTACAGATGTTATTGGCATGAAATTAACACTATAAATACAAGCATT
AGTTCGTTTAGAATGGAAAAGTGTAGCCAATATAGATATAAATAGTATTTATAATTATTA
TTAAAAGCAGTAAATAGATCTAAGAACTGAACTGTTAAAGTTCAGATAATTTATTGCAGC
ATATTTCTATTTGTTTATTTTAAATAAAAAAATCATGTCTAAAGATATTGAGTAAGAGTT
TTATCAAGTTGATAATAGCAATATCGGTATTAAAAAAATGAATCTTAATATTATCCATGG
TTTTTTGTCTTAATTCGCTGAAATTCCTTAATCTAAGGCCATATTAGAAGCTAATCTTCC
TCACTATTTCAAATTAGAAAGGATTTCTTAACTAAAAGAATTAGAAAAGTATTATGGATA
AGATTACATCAAGAATTTGATAAACTCATATAAAGGAGAACATTAAGCATATGTAAGCTA
TTAAATATACCTTTAATAAACTTCTACACTTTAAAATAGTAAACAAAATAATTAGTAATA
ATAATAATAATAATAAAACAACAACAAAATTCTTACTGTTAAAGAATATGCCTATGTAAC
ATTTGATTAAAAAAGATAAATGTTTTCTCACCTAAATATTCCTACTGCTTCATAAGCACC
ATTAAATGAAATTGCAAAAATAGATTCAATGGAAATAGAAGAATAAGCTAAATAAAATAA
AATTTAAGAAAAACATAAACCAACTCATGAAAGTAATATTAATAAAAATAAATAAGTTAG
CGGTTAAAAATCACACCATTAAAATTAAGAGAATATTCACTAAAAAAATTAATTAAAGAC
TAATTAAGTGCAAAATCCAAATTCTTAAGCTTAATCAAAGGCACACCATAATAAAAATGT
ATAGAAAGTTAATAATCCAAATAAATAAACATAAGATTAATTAGGGTAAAAAGATTAGCA
AAATAAGGAATAATAGTAAATGATGAAGGAATAAACTAAAGAAAACTTATAAGTTTAAGA
AGAACCATAGCAAGTTTAAGAAAAACCGTAGCAAATGTAAGAAGAATCATAGAATCTTTA
AGAAGAGTCATAGCAAATTTAAGAAGAGTCATAGCAAGTTTAAGAAGAGTCATAGTAAGT
TTAAGAAGAGTCATAACAAATTTAAGAAGAATCAAAGCAAATTTAAGAACAACAATTGCT
AATTTAAGAAGAATAGTCTTAACAAGTTTAAGAATAAATGTAAATTGAGAATACAGAAAG
CAATAAAAACGAATCTGAAATTGAATAATAAAAAAATTTAGTAAAAGAAAACGAATCTTA
ATCCTAAATAGATATCTAAAAACAATAGAAATCACAAATTGACTTAAAGTAATAGGATTA
GCAATCAATACCAGCCAAATAAAAAGATGAAATTAAAATTAAATCATCCTAAATTTTAGA
ACCAAATAATAAAGAAAGTCATTAAATTGAAGCTTAAGAAGAAAAATAATAGACTTAATA
AGGTTCAATTATTCAGGAAACTGTTCAAAAATCAGAAAAAATGGATATTGAAGAAAATAA
GCAAGAAGAATAGAGTAAATAAGAAAGCTAAATAGTTTAAACAAAAGATTAAAGTTCTTC
TTAAAATACAATCCCTTAAAAGGCATAATTACCTGTTTTATCTATCAAAAAACCTAATAT
TTAATAAAATCTCTCTCAAGCTAACTAATAATCAACAACTTAAACTAACCTAGTTGCATA
AAAATAACCACAAAATATCACCTAAGTACCCACACAAGAACCAAAGGATAAAATAAATAT
CGATTAAAATAATGAGAAATCGTCATAAGCTTTAAATTAGGTAAAACCTAAACTAAGCAT
TAAAGAAAAGGCGTTATTGATGATGAAAAATAAATAAGATGGTGCAAAGTAAAATAATAC
ATAAACTCCTTCTACAGAGTAGATATAATAACAAAATGAAATTTAAACAGAAAAACCTTA
AGAAAACATTCCTAAGCCTGCTATAAGTTTTCCTACTTTAGAATTAAAATAATAATAGCA
ATAAAAGCAAATAGATTAAAAAGCTAAAAATTCTGAATCTCCTGAGAAACAGCCATCTGA
AAATAAGCCTTCAATAGATTTAACTAAAAAGCCTTCTCTTTTGATGATGAAAAAGAAATA
AGAATAACAGACTCCTTCTACCCCAATTAATTAAAATGTTAATACTGAAAAAATGGAAAT
AGAATAAAACTAACCTTAACAAACACTTGAGACCTCTTAAAATACTGAAAAAACCTAATA
AAAACCTGCACTATCATTAAAACCAAAAATTTAAATCAAAAGCTAAGAGAAGCAATAAAC
AGAGCAAACACTACAAAAAGTAGAAGAAAATTTAAAATAAGTAGATAAACCTGAAGAAGG
TGAAGTAAAAGATTTACAAGTAACCGAAAATAAAAAAACTTAATAGATATCACAAGTTAG
TATTGATGAAAAACAAAGCTAAGATCCTTTAAATTAAAATATTAGTGATATATAAAATAA
TATTGAAACTTCAAATGATACAAATGCAGCTGAGTAAAATATAACCGAAAATATAATAGA
AAATAATTTACAGACATAAGAGTAAGTTAAGAGTAAGGAGGATAATTCGTTAAATGTAGA
TAATGATTAAGAAAAAATATTAGAAAATAATCCTGATATTAAAAACGAAAATAGCACAGA
TTAGCTAGAAGAAAAACAGACCTTAGAAGTTGAGTAAGAAGCTTAATAAGTTGAAAGTGA
ACAACTAAATGAAAATTTATAAGAATAAAAATAGGAGGAAGATTAAATAGTTTAAAATAC
TTAAACAGATTAAGAAATATAAAAATTAAATGAAGAGGAAATTTAATAAAATTAAGCAGA
ATTAAATGAAATCGAAATAGAAAATTAAAATGAAGAAAATGATTTAAATAACAAAATTGT
TTAAGATGAGAATTTAGAAGCAGATGCTAATGAGGGATTATTGTAGAATTAAGAATAAAT
TTAAGATGCTTTAAATATAATAGAAGAGGAAGATCAGCAACTAACAATAAGCTAAACTAA
TCAAGATGAATTAATATAAGAGGAAGCAGAGGATTTTTAGGCAAATGAAGAATAAGTAGA
TGAAGCCACTTTAGGATTAGCTCTAAAAACTTAGCAAGAGGAATAATTAAATTAATAAGA
AAACGAATAAGAAAATGAGCAATAATTAAATTAATAGGAAAATGAATAAGAAAATGAGCA
ATAATTAGAATAATAGACTAATGAGTAAGAATAAGATCAAGGATTTACAGATTAGCAAGA
AGAAAACGAATAAAAAAATTTAGAATAAATAAATGAAGAGAATAAGGAATCCAACGAAGA
TAAAGTAGAAGAATAAAATTGA