Identifiers and Description

Gene Model Identifier

TTHERM_00490670

Standard Name

None

Aliases

PreTt08372 | 60.m00169

Description

DnaJ domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00490670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13536.19.997093137033517e-262DnaJ domain-containing protein
(906 aa)
OxytrichaContig19437.0.g142.998830401637127e-79DnaJ domain
DictyBaseDDB_G02865792.0007467515522948e-59dnaja5 on chromosome: 4 positi
on 4649529 to 4651430
SGDYNL227C4.001202823045957e-54JJJ1 Co-chaperone that stimula
tes the ATPase activity of Ssa
1p, required for a late step o
f ribosome biogenesis; associa
ted with the cytosolic large r
ibosomal subunit; contains a J
-domain; mutation causes defec
ts in fluid-phase endocytosis
Stentor CoeruleusSteCoe_330762.1705220113036395e-29
WormBaseWBGene000010290.0000000039998859049333245locus:dnj-11 status:Confirme
d UniProt:Q94216 protein_i
d:CCD67179.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00490670(coding)
ATGAAGACTTGCTATTATGAGCTTCTAGGTGTTGACAGGAAGGCAACAGATGAAGAAATT
AAAAAGGCATATAAAAAAATGGCTTTAAAGTATCACCCAGATAAGAATAGAGAAACAGAT
ACAAAGGAAATCTTTTAAAATCTTATAGAAGCTTATGAAGTGTTGAGTGATCCAAATGAA
AGAGCCTGGTATGATTCACACAGAGAATAAATTTTGAAAGGTACAGGGGGAGATGACATG
AGTAAAGAGGAAATGGAATAAGCAACATATGGTTTTAACATTTGGCCATATTTTAGTCAT
TCATGTTACAAAGGTTTTGATGAATCACAAGAAAATAATTTTTACTAAGTTTATACTGAA
GTTTTTGATAAAATAAAAAATGAAGAATATACTGCTTATCGTTTCTAGTAGGATTTCAAT
GATGAAGAGGAAAAAGTAGAAGAATATGTTGCTCCTCCAGATTTTGGCAATACTAAATCA
CCTTTAGAGTAAGTTTCTGCATTTTATAAGCATTGGGCAGCTTTCACTACTTATAAATCT
TTCAGTTGGTGCGATACTTATAACATAAATGAGGCTCCCAATAGATGGGTAAAGAGACAA
ATGGAAAAAGAAAATAAAAAAGAGAGATAGAATTAAAAAAAGCAATATGCAAAAACAATC
AAGGAGTTAGTTGAGTTTTGCAAGAGAAGAGATCCTAGATGGAAAGATATTTTGGATTAA
CAAAGAAAAGATGATGAAAAGAAGAAAGAAGAACTTAAGTTAAAGAAAGAAGAAGAAAAG
AAGAGAAAGGAGGAATAAAAAATTAGAGCTAGAGAAGAGGAAGAAAGAAGATGGGCTGAG
TTGGATGCTGAAAGATAAAAGTAAGAGGGAGAAGATGACAATGTTTTACCTGAGGAAGAA
CAATACATTGAAGAGTTTTATTGTGAAATATGTAATAAGGGGTTCAAGAGTGAAGCTTAG
CTTTTAAATCATAATAATTCTAATGGCCATAAAAAGAAAATGAAAGAATTGCTTGATGAA
GTTGGTACTTAGCATGAAAGAGACTAGTTCTAATAATAAATTGACTAAGCAAAGCAATCT
TTAAATAAGAATGTTGAAGTTCCTTCAATATCAAAGAAGAAAAAGAACAAAAAGAAATAA
AAATCATAGCAAAATGTCAGCAATAAAAATTTAGATAACAATTCATCTGATGAAGAACAA
GCAGAAGCAGCTGAAGAAGTATTGTCTGATGAGTTAGAAGCTAAGAAAGAAGATAAAAAA
AAGAAAGATAAAGGTAAAGCTAATGAAGCTGATACCAATATTAAAGGTAAATAGAAGAAA
GTAGAAGAATAAGTTGAAGATGAAATTGATTTGAAGAATAAAAGTAAAAAGGCCGTTAAA
GGCAAACAAAAAGCTGAATCAGATGATGAAGAAGAAATTGAGTTGAAACCAAAGGGTAAA
AAAGCAGGCAAAGGCAAACAAAAAGCTGAATCTGAAGAAGATGAATAAGAAGTTCAACAA
AAGAAGCAAGAAGAAGTTGAGGACAAAAAAAATAATAAAAAGAAAACTAAAGGAAATTAA
AAGGAGGAAGAGCCTGCTAAAAAGTAAGCAGTTGCAACTTATGATGATGAAAGTGAAGAG
GAAGAAATTTATTAATCTAATAAATAACATGCAAAGAAGAAAGAAAAGTAAGCCAAAGAA
GAAAAAGCTGCTAAATAAGAAGAAATTACTAAGGCTTCATCAAAAGCTAAGAAAGGTAAA
CATGCTGAAGAAAAAGAGGAAGATAAAAAATTACTTAAAGAAGCTGCTGCAAAATAAAAA
ACTTAAAATTAACCTGAATAAACAAAGGCTAAAAAAGGTAAAAAGCAAGAACAAAAAGGA
AAGCAAGAAAGTGAAGATGATGATAAAAAAGAATAAGCTGAATTTGAAATGTCTCTATTT
GTTTCAAAGAAGTAGTCAGATATTAAAAAAAATTAAGATGAAAATGAATTAGATTACTCA
TACGATTCAGATGGAAATAAGTGCAAGAAAGTTAGCTCTAAGAGTTAAAATAAATAAAAC
ACTGAAACTAATTCCAATAGTGATGAAGATTAAGAAGAGAGTAGTGATGATGAAACTGAT
TTCAAAGGCAAAAATAGTTAGAAATTAAACTAAAAAAAACAAAATGATGAAAAAGAAGAA
GAAGATGATGGATGGTAAAGTGCTAAATTTACGACTAAAAAGTAAGAAAGTAAGCACAAC
CATGAGGCTATGATGAAGAAAAAGCAAGAAGAGAAGGAGTTAAAGATAAAATAGTAATAA
GAAGAACTCAAAAAGAAGTCTCAGTAATAAACTAAATCAAAAAAACAATAAGAAAGCTCA
AGTGAAGAGGAGGAGTCTGAAGAGGAATCAGATGACAGTGATGATGAATTAGCTAGATTT
GCAATGAACATAAAGAAAAAAAATGATGATGATAGTGATGATGAAGGAAATAAAAGAAAG
GGTAAAGGAAAAAGAAGTAAGAGATTGCAAGAAGAAAAGGACAACTTTGATAAAGTTTAA
AAGCAAAAACAAATGGAAAAACTAGATGATAAAACTTACAACAAAGTAATTAAATCCTAG
AAAAAAACTGAAAAGGAAGAGGAAGCAGAAGCTGCATAGCAAGCAGAACTCAACAAGGCC
AAGTAAAAAGAGAAAAGAAAAAAGAAAAAAGAAAAAGAAGAAAAAGAAAAAGAGCTTGGT
TAATTTAAATGCAATACTTGTACATAGCGTTTCTAATCTAAAACAAAGTTATTTGCTCAT
ATCAAAGAAACTGGACATGCTTCAGTAAAAGCATGA


>TTHERM_00490670(protein)
MKTCYYELLGVDRKATDEEIKKAYKKMALKYHPDKNRETDTKEIFQNLIEAYEVLSDPNE
RAWYDSHREQILKGTGGDDMSKEEMEQATYGFNIWPYFSHSCYKGFDESQENNFYQVYTE
VFDKIKNEEYTAYRFQQDFNDEEEKVEEYVAPPDFGNTKSPLEQVSAFYKHWAAFTTYKS
FSWCDTYNINEAPNRWVKRQMEKENKKERQNQKKQYAKTIKELVEFCKRRDPRWKDILDQ
QRKDDEKKKEELKLKKEEEKKRKEEQKIRAREEEERRWAELDAERQKQEGEDDNVLPEEE
QYIEEFYCEICNKGFKSEAQLLNHNNSNGHKKKMKELLDEVGTQHERDQFQQQIDQAKQS
LNKNVEVPSISKKKKNKKKQKSQQNVSNKNLDNNSSDEEQAEAAEEVLSDELEAKKEDKK
KKDKGKANEADTNIKGKQKKVEEQVEDEIDLKNKSKKAVKGKQKAESDDEEEIELKPKGK
KAGKGKQKAESEEDEQEVQQKKQEEVEDKKNNKKKTKGNQKEEEPAKKQAVATYDDESEE
EEIYQSNKQHAKKKEKQAKEEKAAKQEEITKASSKAKKGKHAEEKEEDKKLLKEAAAKQK
TQNQPEQTKAKKGKKQEQKGKQESEDDDKKEQAEFEMSLFVSKKQSDIKKNQDENELDYS
YDSDGNKCKKVSSKSQNKQNTETNSNSDEDQEESSDDETDFKGKNSQKLNQKKQNDEKEE
EDDGWQSAKFTTKKQESKHNHEAMMKKKQEEKELKIKQQQEELKKKSQQQTKSKKQQESS
SEEEESEEESDDSDDELARFAMNIKKKNDDDSDDEGNKRKGKGKRSKRLQEEKDNFDKVQ
KQKQMEKLDDKTYNKVIKSQKKTEKEEEAEAAQQAELNKAKQKEKRKKKKEKEEKEKELG
QFKCNTCTQRFQSKTKLFAHIKETGHASVKA


>TTHERM_00490670(gene)
ATGAAGACTTGCTATTATGAGCTTCTAGGTGTTGACAGGAAGGCAACAGATGAAGAAATT
AAAAAGGTAAATAAAAAAATTTAAGCAGCTCATTTATTTTAAAGGCTGAGTTAGCTAGAA
AATTTGTTTATTAATGCAATGAGAAAACAAAATCTAAAAGGATTATTTTTAATTAGGCAT
ATAAAAAAATGGCTTTAAAGTATCACCCAGATAAGAATAGAGAAACAGATACAAAGGAAA
TCTTTTAAAGTAAATATTAAATGGTTATTTGCTTTTAGAAAATGATTATAATTGTAAATA
AATAGATCTTATAGAAGCTTATGAAGTGTTGAGTGATCCAAATGAAAGAGCCTGGTATGA
TTCACACAGAGAATAAATTTTGAAAGGTACAGGGGGAGATGACATGAGTAAAGAGGAAAT
GGAATAAGCAACATATGGTTTTAACATTTGGCCATATTTTAGTCATTCATGTTACAAAGG
TTTTGATGAATCACAAGAAAATAATTTTTACTAAGTTTATACTGAAGTTTTTGATAAAAT
AAAAAATGAAGAATATACTGCTTATCGTTTCTAGTAGGATTTCAATGATGAAGAGGAAAA
AGTAGAAGAATATGTTGCTCCTCCAGGTAATTAATTATCTTTTAAAATGTTTTATATAAA
ATTAAGGTTAAAAATTCAAGATATTACTTTAAAAGAGGAATCTTTTATGATTCAAAAAAA
GCAAATAGGGATATTTTCCAAAAGCTTAAAATGGCTTTAAAAAATATTATTTTTTCAAGG
AAAGAATAAAGCTTGAAACTAAAATTTAGAAACAATTCAATATAAAATTATGTAGAAAGA
AAATGTTTGATTAATTAATAGTTTGATTATGAAATAAATCATTTAAATATTGCTTAGAAT
GAGTGATAAAAAGAATTAATTTATTTATTGATATGTGTGATAAAAAAAATTGATTTTAGA
ATTTATTTATGATTTTTTGAAAAAATAGATTTTGGCAATACTAAATCACCTTTAGAGTAA
GTTTCTGCATTTTATAAGCATTGGGCAGCTTTCACTACTTATAAATCTTTCAGTTGGTGC
GATACTTATAACATAAATGAGGCTCCCAATAGATGGGTAAAGAGACAAATGGAAAAAGAA
AATAAAAAAGAGAGATAGAATTAAAAAAAGCAATATGCAAAAACAATCAAGGAGTTAGTT
GAGTTTTGCAAGAGAAGAGATCCTAGATGGAAAGATATTTTGGATTAACAAAGAAAAGAT
GATGAAAAGAAGAAAGAAGAACTTAAGTTAAAGAAAGAAGAAGAAAAGAAGAGAAAGGAG
GAATAAAAAATTAGAGCTAGAGAAGAGGAAGAAAGAAGATGGGCTGAGTTGGATGCTGAA
AGATAAAAGTAAGAGGGAGAAGATGACAATGTTTTACCTGAGGAAGAACAATACATTGAA
GAGTTTTATTGTGAAATATGTAATAAGGGGTTCAAGAGTGAAGCTTAGCTTTTAAATCAT
AATAATTCTAATGGCCATAAAAAGAAAATGAAAGAATTGCTTGATGAAGTTGGTACTTAG
CATGAAAGAGACTAGTTCTAATAATAAATTGACTAAGCAAAGCAATCTTTAAATAAGAAT
GTTGAAGTTCCTTCAATATCAAAGAAGAAAAAGAACAAAAAGAAATAAAAATCATAGCAA
AATGTCAGCAATAAAAATTTAGATAACAATTCATCTGATGAAGAACAAGCAGAAGCAGCT
GAAGAAGTATTGTCTGATGAGTTAGAAGCTAAGAAAGAAGATAAAAAAAAGAAAGATAAA
GGTAAAGCTAATGAAGCTGATACCAATATTAAAGGTAAATAGAAGAAAGTAGAAGAATAA
GTTGAAGATGAAATTGATTTGAAGAATAAAAGTAAAAAGGCCGTTAAAGGCAAACAAAAA
GCTGAATCAGATGATGAAGAAGAAATTGAGTTGAAACCAAAGGGTAAAAAAGCAGGCAAA
GGCAAACAAAAAGCTGAATCTGAAGAAGATGAATAAGAAGTTCAACAAAAGAAGCAAGAA
GAAGTTGAGGACAAAAAAAATAATAAAAAGAAAACTAAAGGAAATTAAAAGGAGGAAGAG
CCTGCTAAAAAGTAAGCAGTTGCAACTTATGATGATGAAAGTGAAGAGGAAGAAATTTAT
TAATCTAATAAATAACATGCAAAGAAGAAAGAAAAGTAAGCCAAAGAAGAAAAAGCTGCT
AAATAAGAAGAAATTACTAAGGCTTCATCAAAAGCTAAGAAAGGTAAACATGCTGAAGAA
AAAGAGGAAGATAAAAAATTACTTAAAGAAGCTGCTGCAAAATAAAAAACTTAAAATTAA
CCTGAATAAACAAAGGCTAAAAAAGGTAAAAAGCAAGAACAAAAAGGAAAGCAAGAAAGT
GAAGATGATGATAAAAAAGAATAAGCTGAATTTGAAATGTCTCTATTTGTTTCAAAGAAG
TAGTCAGATATTAAAAAAAATTAAGATGAAAATGAATTAGATTACTCATACGATTCAGAT
GGAAATAAGTGCAAGAAAGTTAGCTCTAAGAGTTAAAATAAATAAAACACTGAAACTAAT
TCCAATAGTGATGAAGATTAAGAAGAGAGTAGTGATGATGAAACTGATTTCAAAGGCAAA
AATAGTTAGAAATTAAACTAAAAAAAACAAAATGATGAAAAAGAAGAAGAAGATGATGGA
TGGTAAAGTGCTAAATTTACGACTAAAAAGTAAGAAAGTAAGCACAACCATGAGGCTATG
ATGAAGAAAAAGCAAGAAGAGAAGGAGTTAAAGATAAAATAGTAATAAGAAGAACTCAAA
AAGAAGTCTCAGTAATAAACTAAATCAAAAAAACAATAAGAAAGCTCAAGTGAAGAGGAG
GAGTCTGAAGAGGAATCAGATGACAGTGATGATGAATTAGCTAGATTTGCAATGAACATA
AAGAAAAAAAATGATGATGATAGTGATGATGAAGGAAATAAAAGAAAGGGTAAAGGAAAA
AGAAGTAAGAGATTGCAAGAAGAAAAGGACAACTTTGATAAAGTTTAAAAGCAAAAACAA
ATGGAAAAACTAGATGATAAAACTTACAACAAAGTAATTAAATCCTAGAAAAAAACTGAA
AAGGAAGAGGAAGCAGAAGCTGCATAGCAAGCAGAACTCAACAAGGCCAAGTAAAAAGAG
AAAAGAAAAAAGAAAAAAGAAAAAGAAGAAAAAGAAAAAGAGCTTGGTTAATTTAAATGC
AATACTTGTACATAGCGTTTCTAATCTAAAACAAAGTTATTTGCTCATATCAAAGAAACT
GGACATGCTTCAGTAAAAGCATGA