Identifiers and Description

Gene Model Identifier

TTHERM_00487030

Standard Name

None

Aliases

PreTt19634 | 59.m00272 | 3680.m00129

Description

thymidine kinase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00265 ) thymidine kinase
  • ( PF05093 ) Protein of unknown function (DUF689)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 29.6%

TetraMine Data

TTHERM_00487030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12210.11.0002434920975502e-91thymidine kinase (236 aa)
OxytrichaContig20698.0.g671.0000099287337047e-53Thymidine kinase
DictyBaseDDB_G02891791.9998745702418095e-48thyB on chromosome: 5 position
2508266 to 2509160
WormBaseWBGene000065681.0000633497921574e-36locus:thk-1 Thymidine kinase
status:Confirmed UniProt:
F3Y5P8 protein_id:CCA65650.1
Stentor CoeruleusSteCoe_28292.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00487030(coding)
ATGCAATTAAAATAACTTATCATAAATATCTAAATATAGTTAATGATAGCTAATATGGTG
ATCTTAATGTTACTATCTATTATTAAGCCTTATTTGAGTTGCTAACCATATGTAGAAGAA
TGGCTAATTATTATTAGCTTTATTTTTTCCCGCATAAAATATTTAATTTAAAGATTAGTT
TTTCATAATTATTCATATAAAATTAATTAAAAAAAATTAACTTAATCATCAAAAAAAAAG
TATATACAAATGAGCATTTCTAATAAGGCTAGAGGATTTATTTCTGTCTATTTTGGACCT
ATGTTTAGTGGAAAATCTACTTCTCTACTTAATGATATTTTAAAATACGAGAGTGAATAA
AAGAAAGTACTCGTTGTTGGATTCGCACATGATAACCGTTATAGCGACGAAGCTGAAATT
GTAACTCACCAACATAAGAAACACCATGCAGTCAAGTGCTTTGAATTAAAAGAAATTGAA
TAATAATATAAAAACTACGACGTTATCGCTATTGATGAAGGATAGTTCTTTTTAGATATT
GCAGATAAATGTGATTAATACGCTAACGATGGTAAAATTGTTATAGTTGCTGCTCTCGAT
GCAACCTTTTAAAGAAAGGCTTTTAATTAAGTATTGAATTTGATCCCAGTTGCTGAAAAA
GTAATTAAATTGAGAGGTAAATGCTCAAGTTGCGAAGAAGATTCATCTTTTTCAAGCAGA
AAAATTAAAAGTAACTTAATAGAATTGATTGGTGGAGAAGATCTTTATGAACCCCTTTGC
AGATCCTGCTTCCTTGCTAAATAATCTAAATAAGAAGAGCTAGATTAGGAAGATAATAGT
TCAGATGGTACATCAGGCTGTTATTAAGAAGGCTAAGATTAAGTATAATTTGCTAAAAAT
CCTAATGGAGAAAATATTGATAATGAAGAAAGTAATAATAGTACAAACGAAACAATATCA
GAAGTTGCAGAATAAATAAAGATAAAGAGCTGA


>TTHERM_00487030(protein)
MQLKQLIINIQIQLMIANMVILMLLSIIKPYLSCQPYVEEWLIIISFIFSRIKYLIQRLV
FHNYSYKINQKKLTQSSKKKYIQMSISNKARGFISVYFGPMFSGKSTSLLNDILKYESEQ
KKVLVVGFAHDNRYSDEAEIVTHQHKKHHAVKCFELKEIEQQYKNYDVIAIDEGQFFLDI
ADKCDQYANDGKIVIVAALDATFQRKAFNQVLNLIPVAEKVIKLRGKCSSCEEDSSFSSR
KIKSNLIELIGGEDLYEPLCRSCFLAKQSKQEELDQEDNSSDGTSGCYQEGQDQVQFAKN
PNGENIDNEESNNSTNETISEVAEQIKIKS


>TTHERM_00487030(gene)
ATGCAATTAAAATAACTTATCATAAATATCTAAATATAGTTAATGATAGCTAATATGGTG
ATCTTAATGTTACTATCTATTATTAAGCCTTATTTGAGTTGCTAACCATATGTAGAAGAA
TGGCTAATTATTATTAGCTTTATTTTTTCCCGCATAAAATATTTAATTTAAAGATTAGTT
TTTCATAATTATTCATATAAAATTAATTAAAAAAAATTAACTTAATCATCAAAAAAAAAG
TATATACAAATGAGCATTTCTAATAAGGCTAGAGGATTTATTTCTGTCTATTTTGGACCT
ATGTTTAGTGGAAAATCTACTTCTCTACTTAATGATATTTTAAAATACGAGAGTGAATAA
AAGAAAGTACTCGTTGTTGGATTCGCACATGATAACCGTTATAGCGACGAAGCTGAAATT
GTAACTCACCAACAGTAAGCACTTTTTGCTTTTTTTTAGAATCTAAGTTTTTAGTTTTAC
CCTTATTGATAAATCTTTATTATAATTAAAGTAAGAAACACCATGCAGTCAAGTGCTTTG
AATTAAAAGAAATTGAATAATAATATAAAAACTACGACGTTATCGCTATTGATGAAGGAT
AGTTCTTTTTAGATGTAAATACTTTTTCTTGTTAAATACCAGATTTATTTTTGCAAAAAA
TCTTAAATAACGAATATTTTTCATAAAAAATAAAAAAAATAGATTGCAGATAAATGTGAT
TAATACGCTAACGATGGTAAAATTGTTATAGTTGCTGCTCTCGATGCAACCTTTTAAAGA
AAGGTAAAAAACTAAGTTTAAACATATTTATTTTTTGACATCTTGAGCTGAAATCGAAAC
AAAGAAATTCTTTTTGGATGAAAGAAATCAGTTTATTTTTCATCAACTATTTCAAAATTT
AAACATTAACAGATATTTGATTACTATCAAGAATCTTCTTCTTTGTTCTCTTATTTTAGC
AATATTAATTATTATATAATCAAATAATTAATTAATTAATTTATCAGTTTCTCCTTTATT
ATAATTTTTAACCTTTAAACAAATATAATAAAAATAGGCTTTTAATTAAGTATTGAATTT
GATCCCAGTTGCTGAAAAAGTAATTAAATTGAGAGGTAAATGCTCAAGTTGCGAAGAAGA
TTCATCTTTTTCAAGCAGAAAAATTAAAAGTAACTTAATAGAATTGATTGGTGGAGAAGA
TCTTTATGAACCCCTTTGCAGATCCTGCTTCCTTGCTAAATAATCTAAATAAGAAGAGCT
AGATTAGGAAGATAATAGTTCAGATGGTACATCAGGCTGTTATTAAGAAGGCTAAGATTA
AGTATAATTTGCTAAAAATCCTAATGGAGAAAATATTGATAATGAAGAAAGTAATAATAG
TACAAACGAAACAATATCAGAAGTTGCAGAATAAATAAAGATAAAGAGCTGA