Identifiers and Description

Gene Model Identifier

TTHERM_00486740

Standard Name

None

Aliases

PreTt19605 | 59.m00243 | 3680.m00100

Description

KOW motif protein; KOW motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00486740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12174.19.997093137033517e-262KOW domain-containing protein
family protein (378 aa)
OxytrichaContig17826.0.g1099.9981864321491e-40DExH-box splicing factor bindi
ng site
DictyBaseDDB_G02899330.0000000000002999981760818895DDB_G0289933 on chromosome: 5
position 3455388 to 3457016
WormBaseWBGene000112370.0000000000019997478866288316Protein mos-2 homolog status
:Confirmed UniProt:Q21924
protein_id:CAA94367.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00486740(coding)
ATGAGTAGTTAACAACCTGATAGTCCTACTATATAAAATGTGCCTTTATAAGAAAGACAC
TTGATGTAAGAAAAAGTAGCCGAAGATATTTCTAAGGAAGCTTATGATTACATGCCTGTA
GAGAGTTTTGGTAGCTTTTTAATTAAAAAAATGGGATATGATGAAAAATAAGGCATTGGT
AGAAAGTAGCAAATAGTTAGACCGATAGAATTTGTACCTAGAAATCATAGACAAGGTTTA
GGAGCTGATCCCATGCCTTCATTTTTATAAAAGTAAAAAGATGGAAAAGAAATCCCAAAG
GGGTTACAAAATTTAGTTAGCAAAACGGGAAAGAGTTATAATTATATTGGAGATAAACTT
ATAGATAAGAATAAATAAATAGATATAAATGATAAGGTAAATATTATAGCTGGAAAGCAT
GAAGGATTGCAAGGTTTTATAACAAAAGTTGACAAAGAAAAAGAAGAATATTTAGTTGAG
TTAAAAAACGGGCAAGTTGTCAAAGTAGATAAAAAATAAGTAAAGTTGATAATACCTGAG
CTGGAAAAGATGTAGGAAGAAACTAAACATAAAGAATAAAGTGATAGCGAAAGTGAAGCA
AGTAGTTAAGGTAATGCTGAATCTGATTAAAGTGAATCAAGTGATGATGAAAAAAGTAGC
AGCGATCATGAGAAGAAAGCCAAGAAATCTAAAAAGATTAAAAAAGACAAAGATAAAAAA
GACAAGAAGAGTAAAAAAGATAAGAAAAGCAAGAAAGATAAAAAGAAGAAAAAAGACTCA
AAAAAGAAAAGACTAAAATGGGTAGAGCCTCTTATTAGAATACGTATTATTAGTAAAAAA
TATAAGGATGGGCAGTTCTACAATGTGAAGGCAATTATATCAGATATAATAGATTGCTAT
ACATTCACAGTAATTACTCCTTCAAAAAACACATTAGAAGATTTAAGAGAAAAGGATATA
GAAACTATCATTCCTGATATTGGAAAAAAAGTTAAAGTACTAACAGGTGAAAATAAAGGT
CATGTAGCTACTTTATTGGAAAGAAATAAAAGGAAAAATGAAGTTGTGGTTCAGATAGTT
GATACTATGGAAACTATTATTTTATCCTAAGATGATGTTTCTGAAGTTGTAGCTTGA


>TTHERM_00486740(protein)
MSSQQPDSPTIQNVPLQERHLMQEKVAEDISKEAYDYMPVESFGSFLIKKMGYDEKQGIG
RKQQIVRPIEFVPRNHRQGLGADPMPSFLQKQKDGKEIPKGLQNLVSKTGKSYNYIGDKL
IDKNKQIDINDKVNIIAGKHEGLQGFITKVDKEKEEYLVELKNGQVVKVDKKQVKLIIPE
LEKMQEETKHKEQSDSESEASSQGNAESDQSESSDDEKSSSDHEKKAKKSKKIKKDKDKK
DKKSKKDKKSKKDKKKKKDSKKKRLKWVEPLIRIRIISKKYKDGQFYNVKAIISDIIDCY
TFTVITPSKNTLEDLREKDIETIIPDIGKKVKVLTGENKGHVATLLERNKRKNEVVVQIV
DTMETIILSQDDVSEVVA


>TTHERM_00486740(gene)
ATGAGTAGTTAACAACCTGATAGTCCTACTATATAAAATGTGCCTTTATAAGAAAGACAC
TTGATGTAAGAAAAAGTAGCCGAAGATATTTCTAAGGAAGCTTATGATTACATGCCTGTA
GAGAGTTTTGGTAGCTTTTTAATTAAAAAAATGGGATATGATGAAAAATAAGGCATTGGT
AGAAAGTAGCAAATAGTTAGACCGATAGAATTTGTACCTAGAAATCATAGACAAGGTTTA
GGAGCTGATCCCATGCCTTCATTTTTATAAAAGTAAAAAGATGGAAAAGAAATCCCAAAG
GGGTTACAAAATTTAGTTAGCAAAACGGGAAAGAGTTATAATTATATTGGAGATAAACTT
ATAGATAAGAATAAATAAATAGATATAAATGATAAGGTAAATATTATAGCTGGAAAGCAT
GAAGGATTGCAAGGTTTTATAACAAAAGTTGACAAAGAAAAAGAAGAATATTTAGTTGAG
TTAAAAAACGGGCAAGTTGTCAAAGTAGATAAAAAATAAGTAAAGTTGATAATACCTGAG
CTGGAAAAGATGTAGGAAGAAACTAAACATAAAGAATAAAGTGATAGCGAAAGTGAAGCA
AGTAGTTAAGGTAATGCTGAATCTGATTAAAGTGAATCAAGTGATGATGAAAAAAGTAGC
AGCGATCATGAGAAGAAAGCCAAGAAATCTAAAAAGATTAAAAAAGACAAAGATAAAAAA
GACAAGAAGAGTAAAAAAGATAAGAAAAGCAAGAAAGATAAAAAGAAGAAAAAAGACTCA
AAAAAGAAAAGACTAAAATGGGTAGAGCCTCTTATTAGAATACGTATTATTAGTAAAAAA
TATAAGGATGGGCAGTTCTACAATGTGAAGGCAATTATATCAGATATAATAGATTGCTAT
ACATTCACAGTAATTACTCCTTCAAAAAACACATTAGAAGATTTAAGAGAAAAGGATATA
GAAACTATCATTCCTGATATTGGAAAAAAAGTTAAAGTACTAACAGGTGAAAATAAAGGT
CATGTAGCTACTTTATTGGAAAGAAATAAAAGGAAAAATGAAGTTGTGGTTCAGATAGTT
GATACTATGGAAACTATTATTTTATCCTAAGATGATGTTTCTGAAGTTGTAGCTTGA