Identifiers and Description

Gene Model Identifier

TTHERM_00483620

Standard Name

None

Aliases

PreTt06296 | 58.m00268 | 3719.m00122

Description

kelch motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00483620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14238.19.997093137033517e-262kelch domain-containing protei
n family protein (435 aa)
OxytrichaContig10059.0.0.g160.000000000000006000101554955223Galactose oxidase, central dom
ain
DictyBaseDDB_G02688600.00000000009001903211590313rngB on chromosome: 1 position
2266964 to 2269912
SGDYGR238C0.000000009996807949091551KEL2 Protein that functions in
a complex with Kel1p to negat
ively regulate mitotic exit, i
nteracts with Tem1p and Lte1p;
localizes to regions of polar
ized growth; potential Cdc28p
substrate
WormBaseWBGene000049720.000019995566179747357locus:spe-26 Spermatocyte pr
otein spe-26 status:Partiall
y_confirmed UniProt:Q10579
protein_id:CAA94610.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00483620(coding)
ATGGAATATATTAAGTTTAAGAAAGGAAGTCCATATCCTGAAAAAAGAGGAGGATCAACT
TTACACTGCGTTGCCAAAAATAAATTTATTTTAATAGGTGGAGGAAATAGATCTAAAGAA
TTTGGAGACATTTGGGAATTAAGCATTTTAGACAATAATGAGTGTGAATGGAAATAGATT
AATATTCCTTTGAGTGCTTTCACTCCTAGGACAGGACACACATCTTCATAAGTTGATGAA
AGCACCATTTACATTTATGGAGGATAGAATTTTACAGAAAACAAACATTATAATGATTTT
TTAAAGTTAGATCTAGATACAAATAGCTTACAAAGGCTTAATAAAAGTAGTGGAGCACTT
AATTTGAACGAACCAACAGAAAGAAATTCCTCAACTTTAGTTTATAATAACATCGATAAA
TAGTTGCTTTTGTTCGGCGGAGCTGATCCTCAAGAACCTCTTAGAGACCTTTATGTCTAT
GATATTTTATTAGGAAAATGGACTAAGGTAGAAACTAAAAATGGTGATGAAATTAAAGGA
TTGGAAATGCACACAGCTCATTTTTACAGTGCAGCTTCCGATTTAAAAAAGAAAAAGAAG
AAGAAAGGAAAGAGCAAAAAGGGATCTAATATAGTAAACCTAGATATTGGTGACTTTACT
AAAGAAGTAGATAGTTAAGGATAAGCTATTCCTCATGAAGCAATTATGAACATACCAAAG
GTGAATATAGAGTTTGATGAAAAGAATGCAATAGTTGAAGATGATAATAATGATGAAATT
GAGGAATTTCCTCATGGGGATGAATAAATTATAGGTAAAGAAGAATAAGAGGAAGAATAA
AAGAATGAAGATAATAAATAAGGAGAATAATAAAAGTAAAAATACATGATTGTAATTGGT
GGAAGATATCTCGATCAAGTAAAAAGTGAAATATATTCCTTGAATCTTTCAAATTATGAA
TGGAAAAGGATAAAAGATTTGCCATTTGAAATATGTGCTCACACATCAACTGTGGTAGAA
GATTCAATTTATATCTTTGGTGGAACTTCGGGCTAAGAGTTCTATGATAAACTTTACATT
TTCTAACTCACTAATTAGAAACTCTATGAATTTGAAATCACTCCATAAGAAAAAAAGCAA
TGCATGTTAACTCCAAGAATGGCATCAGCAATGAGTTATGACCAAGAATCAAAAAAATTG
TATATTTTCGGAGGAGCTTCAATTGAGGATGAAACTACAGCTTTAATATCAATCAATACC
AATAAAATTAATACTTCAAACAGAACAAAAAAAATTTGA


>TTHERM_00483620(protein)
MEYIKFKKGSPYPEKRGGSTLHCVAKNKFILIGGGNRSKEFGDIWELSILDNNECEWKQI
NIPLSAFTPRTGHTSSQVDESTIYIYGGQNFTENKHYNDFLKLDLDTNSLQRLNKSSGAL
NLNEPTERNSSTLVYNNIDKQLLLFGGADPQEPLRDLYVYDILLGKWTKVETKNGDEIKG
LEMHTAHFYSAASDLKKKKKKKGKSKKGSNIVNLDIGDFTKEVDSQGQAIPHEAIMNIPK
VNIEFDEKNAIVEDDNNDEIEEFPHGDEQIIGKEEQEEEQKNEDNKQGEQQKQKYMIVIG
GRYLDQVKSEIYSLNLSNYEWKRIKDLPFEICAHTSTVVEDSIYIFGGTSGQEFYDKLYI
FQLTNQKLYEFEITPQEKKQCMLTPRMASAMSYDQESKKLYIFGGASIEDETTALISINT
NKINTSNRTKKI


>TTHERM_00483620(gene)
ATGGAATATATTAAGTTTAAGAAAGGAAGTCCATATCCTGAAAAAAGAGGAGGATCAACT
TTACACTGCGTTGCCAAAAATAAATTTATTTTAATAGGTAATGCATATATAATTAGCTAA
TTATATAGATTGTATCAAATAAGTGGTAACATTGATAATATAAATAATTAAATTAGGTGG
AGGAAATAGATCTAAAGAATTTGGAGACATTTGGGAATTAAGCATTTTAGACAATAATGA
GTGTGAATGGAAATAGATTAATATTCCTTTGAGTGCTTTCACTCCTAGGACAGGACACAC
ATCTTCATAAGTTGATGAAAGCACCATTTACATTTATGGAGGATAGAATTTTACAGAAAA
CAAACATTATAATGATTTTTTAAAGTTAGATCTAGGTAATTTAAATCAAATTTTAAATGA
AGCAAATAACATTTTAATTTTCCAACAGATACAAATAGCTTACAAAGGCTTAATAAAAGT
AGTGGAGCACTTAATTTGAACGAACCAACAGAAAGAAATTCCTCAACTTTAGTTTATAAT
AACATCGATAAATAGTTGCTTTTGTTCGGCGGAGCTGATCCTCAAGAACCTCTTAGAGAC
CTTTATGTCTATGATATTTGTAAGAAAAAGCAATAATTTATATGGATTAAGGATTTATTT
ATGTTCTAAAAAGTATTAGGAAAATGGACTAAGGTAGAAACTAAAAATGGTGATGAAATT
AAAGGATTGGAAATGCACACAGCTCATTTTTACAGTGCAGCTTCCGATTTAAAAAAGAAA
AAGAAGAAGAAAGGAAAGAGCAAAAAGGGATCTAATATAGTAAACCTAGATATTGGTGAC
TTTACTAAAGAAGTAGATAGTTAAGGATAAGCTATTCCTCATGAAGCAATTATGAACATA
CCAAAGGTGAATATAGAGTTTGATGAAAAGAATGCAATAGTTGAAGATGATAATAATGAT
GAAATTGAGGAATTTCCTCATGGGGATGAATAAAGTATTTAAAAATAAATATTATTTAAT
AACTTAAATGATTGTAAAAATAAAAAAGTTATAGGTAAAGAAGAATAAGAGGAAGAATAA
AAGAATGAAGATAATAAATAAGGAGAATAATAAAAGTAAAAATACATGATTGTAATTGGT
GGAAGATATCTCGATCAAGTAAAAAGTGAAATATATTCCTTGAATCTTTCAAATTATGAA
TGGAAAAGGATAAAAGATTTGCCATTTGAAATATGTGCTCACACATCAACTGTGGTAGAA
GATTCAATTTATATCTTTGGTGGAACTTCGGGCTAAGAGTTCTATGATAAACTTTACATT
TTCTAACTCACTAATTAGAAACTCTATGAATTTGAAATCACTCCATAAGAAAAAAAGCAA
TGCATGTTAACTCCAAGAATGGCATCAGCAATGAGTTATGACCAAGAATCAAAAAAATTG
TATATTTTCGGAGGAGCTTCAATTGAGGATGAAACTACAGCTTTAATATCAATCAATACC
AATAAAATTAATACTTCAAACAGAACAAAAAAAATTTGA