Identifiers and Description

Gene Model Identifier

TTHERM_00483490

Standard Name

None

Aliases

PreTt06283 | 58.m00255 | 3719.m00109

Description

Bromodomain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00483490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14230.13.0001680331469735e-143bromodomain containing protein
(231 aa)
OxytrichaContig18584.0.g1082.00017271388466e-38Bromodomain
DictyBaseDDB_G02938003.9992896861436003e-19DDB_G0293800 on chromosome: 6
position 3334534 to 3337072
Stentor CoeruleusSteCoe_35453.1391327920480296e-17
WormBaseWBGene000174234.0002685161515803e-16status:Confirmed UniProt:O76
561 protein_id:CCD69431.1
SGDYDL070W0.00000000000001000191320216021BDF2 Protein involved in trans
cription initiation at TATA-co
ntaining promoters; associates
with the basal transcription
factor TFIID; contains two bro
modomains; corresponds to the
C-terminal region of mammalian
TAF1; redundant with Bdf1p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00483490(coding)
ATGTCAGCAAAAATAAAATCTACTTTAAAGTTTGTCACGGAAACATCAACCAGAAAAGAA
GATTATAAAAAAATGAATACAGTATTATAATCACTATTTGATAATAGCGACTCTCTAGAG
TTTAGATAACCTGTGGATTACTTAGCTTTAGGATTAACTGACTATCCAAATGTGGTTAAA
AAGCCAATGGACTTATCTACTGTTAAAAATAAAATAAATACACAAAGTTATGACACAATA
GAAGACTTTTTAGATGATATTTAATTAATTTGGGATAATTGTAAATTATATAATGCTTAA
GGATCTTGGATTTGGAAGTTAGCAGATAAATTAGACAAGTACTATAAAAAGCTTATAAAA
AATTATTTGCCTATGGTCCAAGTTCAATAAACAGTTGGAAAAAAAGAGAAGAAAGATGAT
AAAGCAAGCAAATAATAAGATGTGTATATTGATAATTTTTAAGAAGAAAAAAGCTCATTT
ACTGCTAAAATTAAATAACTTACAGAAGAATAGTTAGGTAGTATAGTAGAATAAATTAGA
TTAGAAAATCCTTAAGCATTTATAAGATTAGATAATAAAAAGTTATAAGTTATTGTTGAT
AGCATCAGTTTTGAATCTTTATAAAATTATAATACTTAAATCGATAACTGGTTAATCCCT
GTTAAGACTACAAATAAAAGAAGTAAAAATAATTGA


>TTHERM_00483490(protein)
MSAKIKSTLKFVTETSTRKEDYKKMNTVLQSLFDNSDSLEFRQPVDYLALGLTDYPNVVK
KPMDLSTVKNKINTQSYDTIEDFLDDIQLIWDNCKLYNAQGSWIWKLADKLDKYYKKLIK
NYLPMVQVQQTVGKKEKKDDKASKQQDVYIDNFQEEKSSFTAKIKQLTEEQLGSIVEQIR
LENPQAFIRLDNKKLQVIVDSISFESLQNYNTQIDNWLIPVKTTNKRSKNN


>TTHERM_00483490(gene)
ATGTCAGCAAAAATAAAATCTACTTTAAAGTTTGTCACGTAATTAGTTAAGCTTATAGTT
AGAGTTGTTAGGAATGACTAAAGCATAATTCTATTTAGAAATTGACATTCACAATTTAAA
AAGGCGTTATCGAAGTTAATATTTATTAATTATTTTCAAAAGGGAAACATCAACCAGAAA
AGAAGATTATAAAAAAATGAATACAGTATTATAATCACTATTTGATAATAGCGACTCTCT
AGAGTTTAGATAACCTGTGGATTACTTAGGTAAAACGTTTACTTCATTAGAATATGCTTT
TTTAACTTTTAATCAATAAAATTTAGCTTTAGGATTAACTGACTATCCAAATGTGGTTAA
AAAGCCAATGGACTTATCTACTGTTAAAAATAAAATAAATACACAAAGTTATGACACAAT
AGAAGACTTTTTAGATGATATTTAATTAATTTGGGATAATTGTAAATTATATAATGCTTA
AGGATCTGTAAATATTTTATTTATTAAGATACTTATAAACAAATATGATTAGTTATCGAT
ACATAAATATATGTAAATCTTTTAAATAATTCATTTAATTATTAACAGTGGATTTGGAAG
TTAGCAGATAAATTAGACAAGTACTATAAAAAGCTTATAAAAAATTATTTGCCTATGGTC
CAAGTTCAATAAACAGTTGGAAGTAAATTAATTTACATATTTACTAAATATTGATCGATG
ATAAATTTTTAAAATTAAAATATTAGAAAAAGAGAAGAAAGATGATAAAGCAAGGTAAAC
TTAATTTTTTGAATGAGATAATGAACAAAGAATTTTTAAAAGAAAGATAATGAAATTGAT
TAATCTTTTTTATTAAGGTATTTTAATGAGCTAAAATATTTTTTATAAATTAGCAAATAA
TAAGATGTGTATATTGATAATTTTTAAGAAGAAAAAAGCTCATTTACTGCTAAAATTAAA
TAACTTACAGAAGAATAGTTAGGTAGTATAGTAGAATAAATTAGATTAGAAAATCCTTAA
GCATTTATAAGATTAGATAATAAAAAGTTATAAGTTATTGTTGATAGCATCAGTTTTGAA
TCTTTATAAAATTATAATACGTAAATTTTGAATATTTTTTGAAAACCTATTGAAATTATT
TCTATAAAAATAGTTAAATCGATAACTGGTTAATCCCTGTTAAGACTACAAATAAAAGAA
GTAAAAATAATTGA