Identifiers and Description

Gene Model Identifier

TTHERM_00476640

Standard Name

None

Aliases

PreTt06193 | 58.m00165 | 3719.m00025

Description

60S ribosomal protein L24; Ribosomal protein L24e containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01246 ) ribosomal protein L24e

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.5%

TetraMine Data

TTHERM_00476640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14165.11.0004883026569571e-88ribosomal protein L24e contain
ing protein (159 aa)
OxytrichaContig22478.0.g919.99967697349061e-30Ribosomal protein L24e
DictyBaseDDB_G02802295.998633383648922e-18rpl24 on chromosome: 3 positio
n 3141943 to 3142654
SGDYGR148C0.0000000000010000211161514907RPL24B Ribosomal protein L30 o
f the large (60S) ribosomal su
bunit, nearly identical to Rpl
24Ap and has similarity to rat
L24 ribosomal protein; not es
sential for translation but ma
y be required for normal trans
lation rate
WormBaseWBGene000044360.0000000010002658722841845locus:rpl-24.1 60S ribosomal
protein L24 status:Confirme
d UniProt:O01868 protein_i
d:CCD67324.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00476640(coding)
ATGGTCGTTAGAACTGGTACTTGCTCATTCTGTGAATACAGAATTTACCCCGGTAGAGGT
CAAAGATTCATCGCCAAGGATGGTAGAGGTTTCTTCTTCTTAACCAAGAAGGCTAAATGT
CTTTCCTTAAGAAAGGTTAAGGCCCAAAAGATCACCTGGACCATCGCCAGAAGAAGATTA
TGGAAGAAGGTTAAGGCCACCGATATTGCCCAAAAGAAGAAGAAGAGAAACGTTACCGTC
GCCAGAGCCATCGTTGGTATTTCTCTTGAAGAAATCAATAGAAGAAAGAATCTCGACGCT
TCTCACAAGAAGGCTGAAGCTGAAAAGGCCGTCAGAGAATTGAAATAAAAGAAGGCCAAT
GATATTGAAAAGAAGAGAGCCGACAGAAAGTTGCAAGGAAAGGACGTTAAGGCTGCTAAG
AAGGCTGAAACCAAGAAGACCAAGCAACCCGTCGGTGCTAAGGGTGGCAAAAAGTGA


>TTHERM_00476640(protein)
MVVRTGTCSFCEYRIYPGRGQRFIAKDGRGFFFLTKKAKCLSLRKVKAQKITWTIARRRL
WKKVKATDIAQKKKKRNVTVARAIVGISLEEINRRKNLDASHKKAEAEKAVRELKQKKAN
DIEKKRADRKLQGKDVKAAKKAETKKTKQPVGAKGGKK


>TTHERM_00476640(gene)
ATGGTCGTTAGAACTGGTACTTGCTCATTCTGTGAATACAGAATTTACCCCGGTAGAGGT
CAAAGATTCATCGCCAAGGATGGTAGAGGTTTCTTCTTCTTAACCAAGAAGGCTAAATGT
CTTTCCTTAAGAAAGGTTAAGGCCCAAAAGATCACCTGGACCATCGCCAGAAGAAGATTA
TGGAAGAAGGTTAAGGCCACCGATATTGCCCAAAAGAAGAAGAAGAGAAACGTTACCGTC
GCCAGAGCCATCGTTGGTATTTCTCTTGAAGAAATCAATAGAAGAAAGAATCTCGACGCT
TCTCACAAGAAGGCTGAAGCTGAAAAGGCCGTCAGAGAATTGAAATAAAAGAAGGCCAAT
GATATTGAAAAGAAGAGAGCCGACAGAAAGTTGCAAGGAAAGGACGTTAAGGCTGCTAAG
AAGGCTGAAACCAAGAAGACCAAGCAACCCGTCGGTGCTAAGGGTGGCAAAAAGTGA