Identifiers and Description

Gene Model Identifier

TTHERM_00475319

Standard Name

None

Aliases

3709.m00928

Description

conserved hypothetical protein; deoxyribonuclease TATDN1-like protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.7%

TetraMine Data

TTHERM_00475319

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13205.19.997093137033517e-262hypothetical protein (304 aa)
OxytrichaContig13385.0.g451.9992560499818233e-109TatD related DNase
DictyBaseDDB_G02825311.0000732791548452e-89DDB_G0282531 on chromosome: 3
position 5890637 to 5891733
Stentor CoeruleusSteCoe_242341.1379798735078682e-50
SGDYBL055C1.9990449803848145e-49YBL055C 3-->5 exonuclease and
endonuclease with a possible r
ole in apoptosis; has similari
ty to mammalian and C. elegans
apoptotic nucleases
WormBaseWBGene000007953.0001084582952455e-37locus:crn-2 status:Confirmed
UniProt:G5EG18 protein_id
:CCD65117.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00475319(protein)
MIKNLQKLYFATINSSKFNKMEAKHRFFDIAANLADHTFKGHYYEKKVHDEDVDEVIQRA
ASIGCDRLLIVGGYIEDSIESYKICQKSNKFYCTVGVHPCRANEVEANGRTQEDYFKELD
ELISKHKDKCVAVGECGLDYDRFDYASKETQLKHFEPHFNLAEKYNLPMYLHNRNTGNDF
FDIVRRNRKRFPTGVVHSFTGTEEELKQILELDLYVGINGCSLRDEASLEIVKKIPLDKI
QIETDAPYCEIRNTHPGRKFVKTVFEQKKKEKFVKGFMVKGRNEPCQIIQVLEVLAGVLG
KDEKELSEICYKNTLKMFNLKDE


>TTHERM_00475319(coding)
ATGATTAAAAATTTATAAAAATTATATTTTGCAACAATTAATAGCTCGAAATTTAATAAA
ATGGAAGCAAAACATAGATTTTTTGATATAGCAGCAAATTTAGCAGATCACACTTTTAAA
GGTCACTATTATGAGAAGAAGGTTCACGATGAAGATGTTGACGAAGTAATACAACGTGCA
GCCTCTATTGGTTGTGATCGTCTTTTGATTGTAGGAGGATATATCGAAGATTCTATTGAG
AGCTATAAAATTTGTTAAAAATCTAATAAATTTTACTGCACAGTTGGAGTTCACCCCTGC
AGAGCAAACGAAGTAGAAGCTAATGGAAGAACATAAGAAGACTACTTTAAAGAACTAGAT
GAATTAATTTCTAAGCATAAAGATAAATGTGTAGCTGTAGGAGAATGTGGCTTAGATTAT
GATAGATTTGATTACGCAAGCAAAGAAACATAATTAAAGCATTTCGAACCTCATTTTAAT
TTAGCTGAAAAATATAATTTACCTATGTATTTACATAATCGTAATACAGGAAATGATTTC
TTTGATATTGTTAGAAGAAATAGAAAAAGATTCCCTACAGGAGTAGTTCACTCTTTTACA
GGAACTGAAGAGGAATTAAAATAAATTTTAGAATTAGATTTATATGTTGGCATAAATGGT
TGTTCCCTTCGTGACGAAGCAAGTTTAGAAATTGTTAAAAAAATACCACTTGATAAGATC
TAAATTGAAACAGATGCTCCTTATTGTGAAATTAGAAACACTCACCCTGGAAGAAAGTTT
GTAAAAACAGTTTTTGAATAAAAGAAAAAGGAAAAATTTGTAAAGGGATTTATGGTTAAA
GGTAGAAATGAACCATGCTAAATTATTTAAGTTTTAGAAGTTCTTGCAGGTGTATTAGGT
AAAGATGAAAAAGAATTATCTGAAATTTGCTATAAAAATACACTTAAAATGTTTAATTTA
AAAGATGAGTGA


>TTHERM_00475319(gene)
ATGATTAAAAATTTATAAAAATTATATTTTGCAACAATTAATAGCTCGAAATTTAATAAA
ATGGAAGCAAAACATAGATTTTTTGATATAGCAGCAAATTTAGCAGATCACACTTTTAAA
GGTCACTATTATGAGAAGAAGGTTCACGATGAAGATGTTGACGAAGTAATACAACGTGCA
GCCTCTATTGGTTGTGATCGTCTTTTGATTGTAGGAGGATATATCGAAGATTCTATTGAG
AGCTATAAAATTTGTTAAAAATCTAATAAATTTTACTGCACAGTTGGAGTTCACCCCTGC
AGAGCAAACGAAGTAGAAGCTAATGGAAGAACATAAGAAGACTACTTTAAAGAACTAGAT
GAATTAATTTCTAAGCATAAAGATAAATGTGTAGCTGTAGGAGAATGTGGCTTAGATTAT
GATAGGTAATTTTAAATGACAAATTTAATAAAATATAAAAAGTTTTTATTAAAATGAATA
AAAAGAATAAAATTTATTTTAATTATATTAGTTAGTGCATTTATTTATTGATTTTTTTTT
TAATATAATTTTAGATTTGATTACGCAAGCAAAGAAACATAATTAAAGCATTTCGAACCT
CATTTTAATTTAGCTGAAAAATATAATTTACCTATGTATTTACATAATCGTAATACAGGA
AATGATTTCTTTGATATTGTTAGAAGAAATAGAAAAAGATTCCCTACAGGAGTAGTTCAC
TCTTTTACAGGAACTGAAGAGGAATTAAAATAAATTTTAGAATTAGATTTATATGTTGGC
ATAAATGGTTGTTCCCTTCGTGACGAAGCAAGTTTAGAAATTGTTAAAAAAATACCACTT
GATAAGATCTAAATTGAAACAGATGCTCCTTATTGTGAAATTAGAAACACTCACCCTGGA
AGAAAGTTTGTAAAAACAGTTTTTGAATAAAAGAAAAAGGAAAAATTTGTAAAGGGATTT
ATGGTTAAAGGTAGAAATGAACCATGCTAAATTATTTAAGTTTTAGAAGTTCTTGCAGGT
GTATTAGGTAAAGATGAAAAAGAATTATCTGAAATTTGCTATAAAAATACACTTAAAATG
TTTAATTTAAAAGATGAGTGA