Identifiers and Description

Gene Model Identifier

TTHERM_00475110

Standard Name

None

Aliases

PreTt02310 | 57.m00249 | 3709.m00109

Description

Endonuclease/Exonuclease/phosphatase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR03395 ) sphingomyelin phosphodiesterase
  • ( PF03372 ) endonuclease/exonuclease/phosphatase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00475110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17053.12.9994041385173996e-93endonuclease/Exonuclease/phosp
hatase (498 aa)
OxytrichaContig1164.1.g322.999564368270328e-76Endonuclease/Exonuclease/phosp
hatase family
DictyBaseDDB_G02880171.000403801267624e-40DDB_G0288017 on chromosome: 5
position 978356 to 979732
Stentor CoeruleusSteCoe_27067.095474162284704e-23

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00475110(coding)
ATGAATATGTATGGATAAAAGCTTAATAACTCGAGTAAATAAGAGAGTCCAAGTAGTAGC
TTTCATAGTTCAGATTTTATTAGATTAGTTTAGGATAATATTTTAGAAGATAAAGAAGTA
GAAGAAGTAAAAATATTAACTTATAACCTCTTTATGAGACCACCTTTTGTTAAAAATAAT
GAAGATGATTATAAAAATGAAAGATGCAAGCTTATTATTAAAAATGAAATTCAAAAATTT
GATATAATTTGCTTTCAGGAGCTCTTTAGATTGTTTTCTAATCGCAGACATAAAATGGTC
TATTCTGCTATTAAAAAGGGATTTTTATATCATGTAAGTTCACCTTAGCCTAGCTTTTTT
AAAAGTTATTTTGTTGACGCAGGGCTTACTATTTTAAGTAAATATCCTATTGTTGAGTCA
TGCTTTAGACCTTTTAGATATGGTATATTAGCTGACGGACTTTGCTAAAAAGGAGTGTTG
TATGCAAAAATTAGAGTAAATGAAAGGCATATACATGTTTTAAATACTCACACACAAGCA
AGCTACAATACAAATGAAAAAGAAATTAAATAAACAGTTATAGCTCGGTTAGATTAGTTT
GTGGAGATGAGAAAAATACTTGAAGATTGCTTGAAGTAATATGGATTTGATAGAGGAGAT
ATTTGCATATTTGCTGGAGATTTTAATGTTGATTCTAATCACCCTATACATCCTATTAGA
TTCTTAAATAAGCAGTAGGATTTAAAGGAAATACTTGGCATAAATGATACGTAATAGCAT
TTTGATGAGTATAAAGGGCTAATTGATATATTATCTTGTAAAGGGAAAGACATAGTTTAT
GATGTTGGAAGAACTTCTAATAGTGGTAATCCTCCAATTACATTTGCAGATGTTTATCAA
GATTAAAATGGTGAAATCTAACCTTTAGAAACGGCATTAACTCATTAATGCGATTTGAAA
AGTTTATAATCTTTAGACTATATTATGCACATAATACCTAACGGATTATTAGCAGATTTC
CAAAATAAATTAAGCTTTTCAAATAACTAATAAAGAAGTAAATTTGATAGTAATTTAAAT
CAAACTTTTAAAGGTGGGTATTCTTACTAACTTAGTAATAACAAACTGATGCAAAATTAA
TCTAAAAAACTATCAGATAAAAATTTTGTTGTGGACTTTTCTCGTTCTAAAGTAGAAAAA
TTTTTTGTATAAGGCCAAAAATTCACATAACTATCAGATCATTATGGAGTATCGTGTGTA
TTAAAATTCAAGTGA


>TTHERM_00475110(protein)
MNMYGQKLNNSSKQESPSSSFHSSDFIRLVQDNILEDKEVEEVKILTYNLFMRPPFVKNN
EDDYKNERCKLIIKNEIQKFDIICFQELFRLFSNRRHKMVYSAIKKGFLYHVSSPQPSFF
KSYFVDAGLTILSKYPIVESCFRPFRYGILADGLCQKGVLYAKIRVNERHIHVLNTHTQA
SYNTNEKEIKQTVIARLDQFVEMRKILEDCLKQYGFDRGDICIFAGDFNVDSNHPIHPIR
FLNKQQDLKEILGINDTQQHFDEYKGLIDILSCKGKDIVYDVGRTSNSGNPPITFADVYQ
DQNGEIQPLETALTHQCDLKSLQSLDYIMHIIPNGLLADFQNKLSFSNNQQRSKFDSNLN
QTFKGGYSYQLSNNKLMQNQSKKLSDKNFVVDFSRSKVEKFFVQGQKFTQLSDHYGVSCV
LKFK


>TTHERM_00475110(gene)
ATGAATATGTATGGATAAAAGCTTAATAACTCGAGTAAATAAGAGAGTCCAAGTAGTAGC
TTTCATAGTTCAGATTTTATTAGATTAGTTTAGGATAATATTTTAGAAGATAAAGAAGTA
GAAGAAGTAAAAATATTAACTTATAACCTCTTTATGAGACCACCTTTTGTTAAAAATAAT
GAAGATGATTATAAAAATGAAAGATGCAAGCTTATTATTAAAAATGAAATTCAAAAATTT
GATATAATTTGCTTTCAGGAGCTCTTTAGATTGTTTTCTAATCGCAGACATAAAATGGTC
TATTCTGCTATTAAAAAGGGATTTTTATATCATGTAAGTTCACCTTAGCCTAGCTTTTTT
AAAAGTTATTTTGTTGACGCAGGGCTTACTATTTTAAGTAAATATCCTATTGTTGAGTCA
TGCTTTAGACCTTTTAGATATGGTATATTAGCTGACGGACTTTGCTAAAAAGGAGTGTTG
TATGCAAAAATTAGAGTAAATGAAAGGCATATACATGTTTTAAATACTCACACACAAGCA
AGCTACAATACAAATGAAAAAGAAATTGTAATATTTTTAAAAAAACCTAGATAATTTTCT
ATGAATTGCTATTTTTTTAGATAGTTTAATAAATAATTTCAATTTTTTAGGTCATTCTAA
TTTTATTATATTTGATAAGAAATAAACAGTTATAGCTCGGTTAGATTAGTTTGTGGAGAT
GAGAAAAATACTTGAAGATTGCTTGAAGTAATATGGATTTGATAGAGGAGATATTTGCAT
ATTTGCTGGAGATTTTAATGTTGATTCTAATCACCCTATACATCCTATTAGATTCTTAAA
TAAGCAGTAGGATTTAAAGGTAGAAATAATTCATTTTATAAATTTACTTTCTTAAAATTA
AAATAAAGCTTTAAATAAAATTAAATTAATATTTTAAGGAAATACTTGGCATAAATGATA
CGTAATAGCATTTTGATGAGTATAAAGGGCTAATTGATATATTATCTTGTAAAGGGAAAG
ACATAGTTTATGATGTTGGAAGAGTATTTGATTAAATTTTTAATTTAATTAAAGTAAAAA
ATTATTTTTAAAATACTTAAAATAAAATTTTTAGACTTCTAATAGTGGTAATCCTCCAAT
TACATTTGCAGATGTTTATCAAGATTAAAATGGTGAAATCTAACCTTTAGAAACGGCATT
AACTCATTAATGCGATTTGAAAAGTTTATAATCTTTAGACTATATTATGCACATAATACC
TAACGGATTATTAGCAGATTTCCAAAATAAATTAAGCTTTTCAAATAACTAATAAAGAAG
TAAATTTGATAGTAATTTAAATCAAACTTTTAAAGGTGGGTATTCTTACTAACTTAGTAA
TAACAAACTGATGCAAAATTAATCTAAAAAACTATCAGATGTAATAATTGTCTTTATTGA
ATCATTAATTAATTAAGATATTATTATTAAAATTAATTTATTTTATATTTTTAAATTAAA
AGAAAAATTTTGTTGTGGACTTTTCTCGTTCTAAAGTAGAAAAATTTTTTGTATAAGGCC
AAAAATTCACATAACTATCAGATCATTATGGAGTATCGTGTGTATTAAAATTCAAGTGA