Identifiers and Description

Gene Model Identifier

TTHERM_00474970

Standard Name

None

Aliases

PreTt02296 | 57.m00235 | 3709.m00095

Description

60s Acidic ribosomal protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00428 ) 60s Acidic ribosomal protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00474970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13175.11.0002335610448659e-3860s Acidic ribosomal protein (
107 aa)
DictyBaseDDB_G02833930.0000004998288985444982rplP2 on chromosome: 4 positio
n 661727 to 662322
WormBaseWBGene000044100.0000029996948234116693locus:rla-2 status:Confirmed
UniProt:Q9U1X9 protein_id
:CAB60595.1
SGDYDR382W0.000030009396760408108RPP2B Ribosomal protein P2 bet
a, a component of the ribosoma
l stalk, which is involved in
the interaction between transl
ational elongation factors and
the ribosome; regulates the a
ccumulation of P1 (Rpp1Ap and
Rpp1Bp) in the cytoplasm
OxytrichaContig775.1.g56160s Acidic ribosomal protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00474970(coding)
ATGGGAAAGAAAAGAAATGTAAAACTATCAAAGATAAATAAGAAAAAGAATGTGAAAAAA
TAACAAAAATAAGGCAAACAGGTTTAAAGTTAAGGGATTAAAAATTTAGTACTGCGGAAT
TTAGAGAGGATAAACAATCGGAAGTATAAAGATATTAATTAAAACTTAGATAATTAAATT
CAGAAAAGAATCCTTAATACAAGAAAAAAACATATAACAAAATTATCAAAAATGAAATAC
GTCGCTGCTTACGCTCTCCTCGCCCTCAACGGAAGCCAACCCTCCGAAGCTGATGTCAAG
GCCCTCATCGAATCCGTTAACGGTACCGTTGATGCCACCAAGTTATCCTCTTTCATGAAC
GTCATCAAGGGTAAGAACATCGAAGATGTCATCAAGGCTGGTTTATCCAAGGTTGGTAAC
ATCGGTGGTGCTGCCCCCGCTGCTGCCCCCGCTGCCGCCACTAAGGCCCCTGAAGCCAAG
AAGGAAGAACCTAAGAAGGAAGAACCCAAGAAGGAAGAAGATGACTTCGAAGGTGCTGGT
GATCTTTTCGACTTCTGA


>TTHERM_00474970(protein)
MGKKRNVKLSKINKKKNVKKQQKQGKQVQSQGIKNLVLRNLERINNRKYKDINQNLDNQI
QKRILNTRKKHITKLSKMKYVAAYALLALNGSQPSEADVKALIESVNGTVDATKLSSFMN
VIKGKNIEDVIKAGLSKVGNIGGAAPAAAPAAATKAPEAKKEEPKKEEPKKEEDDFEGAG
DLFDF


>TTHERM_00474970(gene)
ATGGGAAAGAAAAGAAATGTAAAACTATCAAAGATAAATAAGAAAAAGAATGTGAAAAAA
TAACAAAAATAAGGCAAACAGGTTTAAAGTTAAGGGATTAAAAATTTAGTACTGCGGAAT
TTAGAGAGGATAAACAATCGGAAGTATAAAGATATTAATTAAAACTTAGATAATTAAATT
CAGAAAAGAATCCTTAATACAAGAAAAAAACATATAACAAAATTATCAAAAATGAAATAC
GTCGCTGCTTACGCTCTCCTCGCCCTCAACGGAAGCCAACCCTGTAAGAATTAATTTCAA
TTTAACTTGATTTCATTTAATGAAGCACATCTAAGATAAGGCAAAAAATTGATGCAGCTC
TGCATATATGGGTGATTTGAGACATTTTGCTAAAAGCTTTTTGTCAATCATTCATTCTAT
TTGTGGGAGAATTGCATCTAAAAGAAATTTCAAATTAAGAGATGACTCAAAAAGAGTTGA
AATTTACCAAATAAATTAGAGTAAAAAATAAAATAAATCTAGTTTATTTTAATACCAAAT
TTGATGAAGGATTGAAAATATCATCAAAACAAACACTTAAAAGAAGTCAATAATTTATTA
ATTATCACATTGGTTTGATTATTTTTGGCAGGTGATTAGTTTAACGCAATTAAAGTTATA
TAAATGAAAGTGAAAATAGATAGATTTAGTTAAAAGATAGATGATATTTGTAATAACTTA
GGGTATATTATTGTATATTTAAAAGAACTGACTAGCAAGACTTAAATAATTCTTCTAATA
ATAACTAACTTATTCATACATTTTGATTCATTCAATAAATCATACATAATAATATTAAAA
TTTTCAAATTCTTAGGTATTTGAAAATATAATATCTAATAATTACTAATTGAAGAAGCAA
AAGCTAAAATAAGTAAAAATAGTCATTCAATTAATAAAGAAAGAAATAATGCTAGAGATC
CAAATTATTTTAATATGAAAATAATTAAATAAGCAACTGATAGTAATAAAAGGTATTCAC
AAGCGAATTCAGAAATTTCAAGTATTTTAAAATATTTGAATAATAAAAAATCTATGCTTA
AAATCTATCTTTGAATTTCTCTATCTTGCTCACTTTTAAAATGCCAGCCAACATAAAATA
AATATCAACTAAATGTAAAAGATAAAAAATATTATTAATAAATAATTTATTGCTTCTCAC
TTCTACTCTAAAATCCTAATAAGAATAATTTAAAAAAATAATAATAAAATTTGGTGCAAT
AATTTTATTGGTAAAATTCAAACACTCTTTTTGCGAGTCTCTTTTTTGAGCATAGAATAT
AGAAATAAGTGCATATAAATATTTTCAATTTTTGAAATAAGATAGTTTTAATCCGAATAT
TAAATTATTTCGTTTAAATTAATAGCCGAAGCTGATGTCAAGGCCCTCATCGAATCCGTT
AACGGTACCGTTGATGCCACCAAGTTATCCTCTTTCATGAACGTCATCAAGGGTAAGAAC
ATCGAAGATGTCATCAAGGCTGGTTTATCCAAGGTTGGTAACATCGGTGGTGCTGCCCCC
GCTGCTGCCCCCGCTGCCGCCACTAAGGCCCCTGAAGCCAAGAAGGAAGAACCTAAGAAG
GAAGAACCCAAGAAGGAAGAAGATGACTTCGAAGGTGCTGGTGATCTTTTCGACTTCTGA