Identifiers and Description

Gene Model Identifier

TTHERM_00474360

Standard Name

CMCB1 (Conjugation induced Macronuclear Chromatin Binder 1)

Aliases

PreTt02237 | 57.m00176 | 3709.m00036

Description

This gene was found to be expressed during conjugation by RT-PCR. Tagging with YFP showed localization to the macronucleus. Chromatin spreading of fluorescent induced cells showed that the protein was bound to the chromatin.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00096 ) Zinc finger, C2H2 type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00474360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13119.16.0018831389078936e-89hypothetical protein (216 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00474360(coding)
ATGTCTCAACAGATTAAATGCCCAGCTAAAGAGCCAATGCATCATGCAGGTGTGAATCAA
GCAGGAATAAGAAAACATATATATTCATGCAAAGCTTTGAAAAGGAAGGATGCTGATACA
ATTGTTTACTAATGCTAATATTGTCAAATTCATTTTTACCTGTCAAAGTAAGATCTCGAA
CAACATGTAAAACTGTGCAGCCTTTCTTATCCAAAAAAAATTGAATGGAATGAAAGAATA
AACACTATCATCATCCCAGCTGATCCTCACTTAAAAATTATAGATCCTAAAGAAGCATGT
AAAAACTGGGAATACTATAGAGATAGAAATAAAAAAATGAAGGAAATGAAAAGACTAAGT
GTGTAGCCATCATCAAATACTAGTCTTAATTCTTAAAACGATGATAGCAATAGATCTTAA
TCTCCATGCAAAATAAATTCACCTAGTAAAATAAAAAAATTAAAACCTTCTGAAAGCTAA
TAATGTTATCCTACTCAGGAACTCTCATAAGAAGAAATATTAAGACAAGAATAGCTGATG
AAAGAAAACGATGAAAAAATTAGAGTTTAATATCTTGAAGAGCTTAAAAATAGAATCAAA
GTTGATGATTACTAAGACAACCTATATACTAATTGA


>TTHERM_00474360(protein)
MSQQIKCPAKEPMHHAGVNQAGIRKHIYSCKALKRKDADTIVYQCQYCQIHFYLSKQDLE
QHVKLCSLSYPKKIEWNERINTIIIPADPHLKIIDPKEACKNWEYYRDRNKKMKEMKRLS
VQPSSNTSLNSQNDDSNRSQSPCKINSPSKIKKLKPSESQQCYPTQELSQEEILRQEQLM
KENDEKIRVQYLEELKNRIKVDDYQDNLYTN


>TTHERM_00474360(gene)
ATGTCTCAACAGATTAAATGCCCAGCTAAAGAGCCAATGCATCATGCAGGTGTGAATCAA
GCAGGAATAAGAAAACATATATATTCATGCAAGTAAAAAATAAATAAATATTTACTCATT
TTAAATACTTAAATTTTATTTTTATATAAAATAAAAATAGAGCTTTGAAAAGGAAGGATG
CTGATACAATTGTTTACTAATGCTAATATTGTCAAATTCATTTTTACCTGTCAAAGTAAG
ATCTCGAACAACATGTAAAACTGTGCAGCCTTTCTTATCCAAAAAAAATTGAATGGAATG
AAAGAATAAACACTATCATCATCCCAGCTGATCCTCACTTAAAAATTATAGATCCTAAAG
AAGCATGTAAAAACTGGGAATACTATAGAGATAGAAATAAAAAAATGAAGGAAATGAAAA
GACTAAGTGTGTAGCCATCATCAAATACTAGTCTTAATTCTTAAAACGATGATAGCAATA
GATCTTAATCTCCATGCAAAATAAATTCACCTAGTAAAATAAAAAAATTAAAACCTTCTG
AAAGCTAATAATGTTATCCTACTCAGGAACTCTCATAAGAAGAAATATTAAGACAAGAAT
AGCTGATGAAAGAAAACGATGAAAAAATTAGAGTTTAATATCTTGAAGAGCTTAAAAATA
GAATCAAAGTTGATGATTACTAAGACAACCTATATACTAATTGA