Identifiers and Description

Gene Model Identifier

TTHERM_00473350

Standard Name

None

Aliases

PreTt02235 | 57.m00174 | 3709.m00035

Description

ubiquitin family protein putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00473350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13117.19.997093137033517e-262ubiquitin family protein (434
aa)
OxytrichaContig10974.0.g367.003455847728069e-40Uncharacterized conserved prot
ein (DUF2363)
DictyBaseDDB_G02790052.9990241513684e-21DDB_G0279005 on chromosome: 3
position 1507522 to 1509663
Stentor CoeruleusSteCoe_184720.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00473350(coding)
ATGCTAAGCAAAAAAGATATAGAGAATTTAATGGAACTACTTATGCTAGATCCAGATATC
ACTTTAGAAGGATTATTCTAAACGTTTATCAAAAAATATAACAGCGAATACCATAATTTA
TTTAGACCATGCTCACTCTGTCTGTGCTTACTAAAAGAAAATCTGATTACAGAATAGTAA
AGGTTAACGAGCATATTTCTCATTATGGAATCTTACAAAAACGATTAAAAAGCTAATCCA
TTTATTGCTAATTTGATAGATGTAATTTTACAATATAATGATCAATATGAAGCTAAGCTC
TTTTAGAGATTATACAGCAGTAATCTAAAAGAGAAGGAATAATTTAGCAAATAACAATTA
GGAATTCTCTTTTAAGAAAAAGATAGCCATAAATATGTAGCATCAACAGTTTATTAAGAT
AAAATCAAGGAAATCAAAGCAAAATATATAGATTCTTTACCTCGAAATCTTTTGGCTTAT
AATTATGGAACGACAAATATATTATGTGATTTTAATCTTTCAGACGATTTATAAAACTTT
CCTCCATAAGTATCTATACTACCAGAATAGTTAAATTTATGTGAATAAGATTGCATGCTT
TTTATGCCAGATACACTTAGACCTATACCTTAAAGTGAAGATTTGGGGATAGATGAGGAA
GAGTGGCTAAATCCAAGTTTAGTAACAGAACATTTATGGGATTACAAGATTTGTGAGCCA
AGTGATAAAAAAATATTACTTTAAGAGATTTTAATCAAAGCATATGAAACGAAGTTAAAT
GATTTAGAATATGATTTATTTAAGAAAGAACTTGAGTAAGATGATGTAAATATAAGAGAT
TTAGAATTAAATACTGAATTACTGCCCAAGCTAGTTGAAAATAATAATAAAATAGCAAGC
TTATTATTGATAAAAATAGCTAAGGAAAAAGAGTTGACATAATATTTAGAAAAGATTTCA
ACTCTTGATTTAACTTTATAATCTTTAGAAGTAGTAAATGATTTGATTAACAACGTTAAT
TTGCCAAAAGAGTTTATTTATTTATACGTTAGCAACATTATTTAATAGTGCGATGAGAAT
AAAAAAGAAAAAAACTAGCATCAAAGATTAGTTAGGCTGGTTTGCGTATTTATAAGATAA
TTAATAAAATCCCAGAGCATAAATCCTAAAGAAAATTTTATAGAGCTGTAAGCATTCAGT
ATTGAGAACTCAAAAATACCTGAAGCAACCACTTTGTTTAAATTGTTAAAAGACCTTGAT
AATGAACCAAACAATAATAATCACAATAATAATTATCACTGA


>TTHERM_00473350(protein)
MLSKKDIENLMELLMLDPDITLEGLFQTFIKKYNSEYHNLFRPCSLCLCLLKENLITEQQ
RLTSIFLIMESYKNDQKANPFIANLIDVILQYNDQYEAKLFQRLYSSNLKEKEQFSKQQL
GILFQEKDSHKYVASTVYQDKIKEIKAKYIDSLPRNLLAYNYGTTNILCDFNLSDDLQNF
PPQVSILPEQLNLCEQDCMLFMPDTLRPIPQSEDLGIDEEEWLNPSLVTEHLWDYKICEP
SDKKILLQEILIKAYETKLNDLEYDLFKKELEQDDVNIRDLELNTELLPKLVENNNKIAS
LLLIKIAKEKELTQYLEKISTLDLTLQSLEVVNDLINNVNLPKEFIYLYVSNIIQQCDEN
KKEKNQHQRLVRLVCVFIRQLIKSQSINPKENFIELQAFSIENSKIPEATTLFKLLKDLD
NEPNNNNHNNNYH


>TTHERM_00473350(gene)
ATGCTAAGCAAAAAAGATATAGAGAATTTAATGGAACTACTTATGCTAGATCCAGATATC
ACTTTAGAAGGATTATTCTAAACGTTTATCAAAAAATATAACAGCGAATACCATAATTTA
TTTAGACCATGCTCACTCTGTCTGTGCTTACTAAAAGAAAATGTATTTTCAGAATTAAAA
TTTTAATTCTAATTGGGCTAATATTTAAATAACAAAGATAATTTAATGATAAATAAGTTA
CATTTAATAAGCGAAAAGAAATAGTTTAAACTAATAATAATGTTTAATATAAACAATAGC
TGATTACAGAATAGTAAAGGTTAACGAGCATATTTCTCATTATGGAATCTTACAAAAACG
ATTAAAAAGCTAATCCATTTATTGCTAATTTGATAGATGTAATTTTACAATATAATGATC
AATATGAAGCTAAGCTCTTTTAGAGATTATACAGCAGTAATCTAAAAGAGAAGGAATAAG
TATTTTATTATTCATAATAAATAGAATATTTTAAATTGCTTTTTTAATGTAAAAATTATA
AATAGTTTAGCAAATAACAATTAGGAATTCTCTTTTAAGAAAAAGATAGCCATAAATATG
TAGCATCAACAGTTTATTAAGATAAAATCAAGGAAATCAAAGCAAAATATATAGATTCTT
TACCTCGAGTAATAACCTATTACATTTTAATGAAATTGGAATTGATCATAATAGATAATC
AATCATTAATTATTGATAAATAGCTCACTCCTTTTATATACTTTGAACTTTATTTTTTAA
TATAAAAAAGAATCTTTTGGCTTATAATTATGGAACGACAAATATATTATGTGATTTTAA
TCTTTCAGACGATTTATAAAACTTTCCTCCATAGTAAAAAGAATAAAAAATGTTATTAAT
TAATTTAAATTCTTAATCGATAATAGAGTATCTATACTACCAGAATAGTTAAATTTATGT
GAATAAGATTGCATGCTTTTTATGCCAGATACACTTAGACCTATACCTTAAAGTGAAGAT
TTGGGGATAGATGAGGTAAATTATAAATAAATTATTTATTTTGAAACAAACTAATTGATT
GAAAAAATATTTTATTTAACAGGAAGAGTGGCTAAATCCAAGTTTAGTAACAGAACATTT
ATGGGATTACAAGATTTGTGAGCCAAGTGATAAAAAAATATTACTTTAAGAGATTTTAAT
CAAAGCATATGAAACGAAGTTAAATGATTTAGAATATGATGTATATATATATAAATAATA
AGCCAACTTTGTTTGATTAAAAATAATTTTATTTAAAAAGTTATTTAAGAAAGAACTTGA
GTAAGATGATGTAAATATAAGAGATTTAGAATTAAATACTGAATTACTGCCCAAGCTAGT
TGAAAATAATAATAAAATAGCAAGCTTATTATTGATAAAAATAGCTAAGGAAAAAGAGTT
GACATAGTAAATACAACTGATTATATTTTCTTTTTGATATAATTGTAATTTAAAAATTTA
AAAATAGATATTTAGAAAAGATTTCAACTCTTGATTTAACTTTATAATCTTTAGAAGTAG
TAAATGATTTGATTAACAACGTTAATTTGCCAAAAGAGTTTATTTATTTATACGTTAGCA
ACATTATTTAATAGTGCGATGAGAATAAAAAAGTAAATATTTATTTATTAAGAAGACATT
CAAGAAAATAAAATGACTAATTTTTATAAATGAAATAGGAAAAAAACTAGCATCAAAGAT
TAGTTAGGCTGGTTTGCGTATTTATAAGATAATTAATAAAATCCCAGAGCATAAATCCTA
AAGAAAATTTTATAGAGGTATAGAAAATTAATTTATAATTTAAAATAATATTTGATAAAA
TTTAATATATAAAAAGCTGTAAGCATTCAGTATTGAGAACTCAAAAATACCTGAAGCAAC
CACTTTGTTTAAATTGTTAAAAGACCTTGATAATGAACCAAACAATAATAATCACAATAA
TAATTATCACTGA