Identifiers and Description

Gene Model Identifier

TTHERM_00473010

Standard Name

None

Aliases

PreTt02201 | 57.m00140 | 3709.m00001

Description

Kelch motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00473010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13081.19.997093137033517e-262kelch domain-containing protei
n family protein (734 aa)
OxytrichaContig3100.0.g757.001594317853847e-31Galactose oxidase, central dom
ain
DictyBaseDDB_G02812099.99967697349061e-30DDB_G0281209 on chromosome: 3
position 4207203 to 4209040
WormBaseWBGene000018270.00000000000001000191320216021locus:hcf-1 status:Confirmed
UniProt:G5EC23 protein_id
:CCD66593.1
Stentor CoeruleusSteCoe_309750.000000000000012664165549094176
SGDYGR238C0.00000000000009996062864481225KEL2 Protein that functions in
a complex with Kel1p to negat
ively regulate mitotic exit, i
nteracts with Tem1p and Lte1p;
localizes to regions of polar
ized growth; potential Cdc28p
substrate

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00473010(coding)
ATGATTGAAGAGTTTTTACACGAAAACACATGGATAAAATTATAAGCAGAAGGAGATATC
CCTTGTCCAAGGACAGGCCATAGTGCCTGCTCTTTTAAAAACGAATGCATGTACATTTTC
GGTGGGTATTCAGATGAAAAAGCTCTAAATGACATGTATAAATATAACATATTATCTAAA
ACATGGGAAAAAATCGAGTATTAGAATTCAATAAGTGAGATACCTTCTGGTAGAGCTTCT
GCATAGTTATGTGCATACTCTGAAATGGGTAAGATATATTTATTTGGAGGAACAGGAATG
GAAGTTAATGAGCACTCAGCAAATGATCTGTATGAGTTTGATGTCAATTAAAAAACATGG
AGGATTATTGAAACAGGAAAATATAGTCCATGCGAAAGATATGGACACTCTATGACTTTA
CATAATAATTTTCTAATTCTTTTTGGAGGAGCAAGGATAGTTAAATAAGGAAATAAATTA
GTTTCAGAGTACCTAAATGATTTATGGATGCTCTCTCTTCTTGATAAAAACTGGAGAAAA
ATAACTCCAGGAGGTACTATACCTTCTCCTAGATATAGATAAGAAATAATCATTCATAAC
AATGGATTATATTTAATTGGAGGAGGCACAACAAATGAGAGATTCAGCTCAATTTTTAAA
TATGAATTTTCACAAAATTCGTGGACTTAAGTTAATTTGGCAAACTAAAATTCAAACAAT
AAAAAAGATTTAATTTTTAAGGGTCGAATGGGTCATATTTGTATCTTAGATAATGAAGAA
ATACTGTTGTATGGGGGTGTTGATGATGTAGTAAATACAGATCCATTAAGTTACTCAATA
GATAAAAGAATGTGGAGGAAAATATTTATAAGAGGGAAGCACCCTAAGCCAAGGGAATTC
TTTAGTGGTTGTAAATTTCATCACTCAATAATTATATTTGGAGGAAGAGTTGGGTAGAAA
AAAGTAAATGATTTATATATTTGGAATATTTCCTGTCCTACACCAACTAAAAAGCACTGC
ACTTTAAAATTAGAGATGTTGCAACTCTTCTATACTTAAGAAAATTAAGGAGATTGGGTT
ATAACTTGTAAAAAAGATAGCAAGACAATATCTGCTCATTCTTATATAATTAGGCATCGC
TCTAATAGATTTTATGAACATCTAAAATAATCAAATTTAATTTTTGATGGCTGCTCTAAA
TTATTGACACATATTTTACATTTTATTTATAGTGGAGAAGTTAACTTTGCTCAAATTAAT
CCAGAAATAATTACAGTTTTAATTGAGTTTAGTATAAGCTCTGAAATGAAATATTTTTTT
AGGATAATCATTTTGCATTGCTTAGTTACTTCTGCCAACTAAGACGAACTCAATATATTA
GATGGTATTTTAAGGAGTTTACAAAATAAGTGTAATGAATCTTAAAATCCATTTTTTAAA
AGTTTACTCAATTGGATGGATTTGAGAAGAAATATCAAATAGAATTAACCCTCTCAGTCA
ACACCTACTAGTAGAAGCTAAAATAGAAGAGAGAGTGACATTAATGGAGAAATTTTTAAA
AGTTTAAATAGCTTTTAATAATCTTTTGACTCCGTTTTTCACCTAAATACTATGCTTTAT
TATTCAGATTTCAATTAATTGAAGCTAGATACTGATACTTCAAACTTTTGCTTTGTATAT
GAAAATAAATAATATAAGGTTCACACTGCAATTCTTTCAGCAAGATGTGGATATTTTGAA
AGCTATTTTAATGTACATAGTCTTCTATCTTAATAAAATGAAATGGTCATTCAACCATTT
TTGATTCACTCTAACACTTAACTATTAGAATTCTTTATTTTTTACTTATATAACGGAATG
GAAGCTTTTACAAAATTCAAGCTCACTACAGAAAATCTGATAAATCTTCTAGATATTACA
AATTATTTTATGATTAAAAGTCCTACATTTAATTACTTAATAGAAAATGCTATTTTCAAT
GAAGGAATAACTTTAGAAAATTGCTTAAAGAATATGCAGTTTGCTGAGCAATTCAATGCA
ATATTTCTGAGAAGTAAAATTCTATCTTTTATGGTTCAGAATATGTCTAAAGTTTTAAAG
CTTTATGAAAAAGATCTACTTGCTATGAATCCACACTTTTTAGTTGAAATGATAAGAATG
TAGAATGATCAAATAATTTCTTATAATTTATGA


>TTHERM_00473010(protein)
MIEEFLHENTWIKLQAEGDIPCPRTGHSACSFKNECMYIFGGYSDEKALNDMYKYNILSK
TWEKIEYQNSISEIPSGRASAQLCAYSEMGKIYLFGGTGMEVNEHSANDLYEFDVNQKTW
RIIETGKYSPCERYGHSMTLHNNFLILFGGARIVKQGNKLVSEYLNDLWMLSLLDKNWRK
ITPGGTIPSPRYRQEIIIHNNGLYLIGGGTTNERFSSIFKYEFSQNSWTQVNLANQNSNN
KKDLIFKGRMGHICILDNEEILLYGGVDDVVNTDPLSYSIDKRMWRKIFIRGKHPKPREF
FSGCKFHHSIIIFGGRVGQKKVNDLYIWNISCPTPTKKHCTLKLEMLQLFYTQENQGDWV
ITCKKDSKTISAHSYIIRHRSNRFYEHLKQSNLIFDGCSKLLTHILHFIYSGEVNFAQIN
PEIITVLIEFSISSEMKYFFRIIILHCLVTSANQDELNILDGILRSLQNKCNESQNPFFK
SLLNWMDLRRNIKQNQPSQSTPTSRSQNRRESDINGEIFKSLNSFQQSFDSVFHLNTMLY
YSDFNQLKLDTDTSNFCFVYENKQYKVHTAILSARCGYFESYFNVHSLLSQQNEMVIQPF
LIHSNTQLLEFFIFYLYNGMEAFTKFKLTTENLINLLDITNYFMIKSPTFNYLIENAIFN
EGITLENCLKNMQFAEQFNAIFLRSKILSFMVQNMSKVLKLYEKDLLAMNPHFLVEMIRM
QNDQIISYNL


>TTHERM_00473010(gene)
ATGATTGAAGAGTTTTTACACGAAAACACATGGATAAAATTATAAGCAGAAGGAGATATC
CCTTGTCCAAGGACAGGCCATAGTGCCTGCTCTTTTAAAAACGAATGCATGTACATTTTC
GGTGGGTATTCAGATGAAAAAGCTCTAAATGACATGTATAAATATAACATATTATCTAAA
GTAAATTTAATTTCAACAAATATGGATACAAAAAGTTATTATTAAATATTTAATAAAGAC
ATGGGAAAAAATCGAGTATTAGAATTCAATAAGTGAGATACCTTCTGGTAAATATTTTGT
TTTTGATTTATATATGATAGATATAATTTTTTTATTTTTTAGGTAGAGCTTCTGCATAGT
TATGTGCATACTCTGAAATGGGTAAGATATATTTATTTGGAGGAACAGGAATGGAAGTTA
ATGAGCACTCAGCAAAGTAATTTTATTTTATTTTTTGATTTTAATTAAAAACAATTAAAT
ACAGTGATCTGTATGAGTTTGATGTCAATTAAAAAACATGGAGGATTATTGAAACAGGAA
AATATAGTCCATGCGAAAGATATGGACACTCTATGACTTTACATAATAAGTATATATGAG
TTTGAAATCAAAAATTTGTTTTGAGCTTAATTATTTATCTATTAGTTTTCTAATTCTTTT
TGGAGGAGCAAGGATAGTTAAATAAGGAAATAAATTAGTTTCAGAGTACCTAAATGATTT
ATGGATGCTCTCTCTTCTTGATAAAAACTGGAGAAAAATAACTCCAGGAGGTACTATACC
TTCTCCTAGATATAGATAAGAAATAATCATTCATAACAATGGATTATATTTAATTGGAGG
AGGCACAACAAATGAGAGATTCAGCTCAATTTTTAAATATGAATTTTCACAAAATTCGTG
GACTTAAGTTAATTTGGCAAACTAAAATTCAAACAATAAGTTAATTGATTTTTACAATTT
CAAATTAGTTATTAATTAATTTAAATGTATAAATCAGAAAAGATTTAATTTTTAAGGGTC
GAATGGGTCATATTTGTATCTTAGATAATGAAGAAATACTGTTGTATGGGGTAAACATAT
GCTTGCTTTTTATGTTTTTATATAAAACTAATGAAAAAAATAGGGTGTTGATGATGTAGT
AAATACAGATCCATTAAGTTACTCAATAGATAAAAGAATGTGGAGGAAAATATTTATAAG
AGGGTATCTTTTATAAACTAATTAATTATTTATTCAGTTTATTTATAATTTGCTAATAAA
CTTAATTAATTATTCTTTTAATAGGAAGCACCCTAAGCCAAGGGAATTCTTTAGTGGTTG
TAAATTTCATCACTCAATAATTATATTTGGAGGAAGAGTTGGGTAGAAAAAAGTAAATGA
TTTATATATTTGGAATATTTCCTGTCCTACACCAACTAAAAAGCACTGCACTTTAAAATT
AGAGATGGTAAAATTTTAATTAATTCTTTTAAAAATGATGATTAAATTTTTATCAATTTA
AAGTTGCAACTCTTCTATACTTAAGAAAATTAAGGAGATTGGGTTATAACTTGTAAAAAA
GATAGCAAGACAATATCTGCTCATTCTTATATAATTAGGCATCGCTCTAATAGATTTTAT
GAACATCTAAAATAATCAAATTTAATTTTTGATGGCTGCTCTAAATTATTGACACATATT
TTACATTTTATTTATAGTGGAGAAGTTAACTTTGCTCAAATTAATCCAGAAATAATTACA
GTTTTAATTGAGTTTAGTATAAGCTCTGAAATGAAATATTTTTTTAGGATAATCATTTTG
CATTGCTTAGTTACTTCTGCCAACTAAGTATTTAATTTAAAATCTTAAAAGTATCTGAGC
AAATATTATTCAAATTATTAGGACGAACTCAATATATTAGATGGTATTTTAAGGAGTTTA
CAAAATAAGTGTAATGAATCTTAAAATCCATTTTTTAAAAGTTTACTCAATTGGATGGAT
TTGAGAAGAAGTAATTAGATTTTAAGTTGTTTGAATTTAAATTTATTTTACGTTAAATTA
GATATCAAATAGAATTAACCCTCTCAGTCAACACCTACTAGTAGAAGCTAAAATAGAAGA
GAGAGTGACATTAATGGAGAAATTTTTAAAAGTTTAAATAGCTTTTAATAATCTTTTGAC
TCCGTTTTTCACCTAAATACTATGCTTTATTATTCAGATTTCAATTAATTGAAGCTAGAT
ACTGATACTTCAAACTTTTGCTTTGTATATGAAAATAAATAATATAAGGTTCACACTGCA
ATTCTTGTAAGCTAAATCAAATAACTATTTTTATTTTAAAGAAACAGTTTTTAATTTATT
TTAAATTAAAAAATTCATTTATTAGTCAGCAAGATGTGGATATTTTGAAAGCTATTTTAA
TGTACATAGTCTTCTATCTTAATAAAATGAAATGGTCATTCAACCATTTTTGATTCACTC
TAACACTTAACTATTAGAATTCTTTATTTTTTACTTATATAACGGAATGGAAGCTTTTAC
AAAATTCAAGCTCACTACAGAAAATCTGATAAATCTTCTAGATATTACAAATTATTTTAT
GATTAAAAGTCCTACATTTAATTACTTAATAGAAAATGCTATTTTCAATGAAGGAATAAC
TTTAGAAAATTGCTTAAAGAATATGCAGGTAAGTTTAAAATTGTATGTAGATAAAAATGA
AAGTTAAATTAATAAATTTATTAATAGTTTGCTGAGCAATTCAATGCAATATTTCTGAGA
AGTAAAATTCTATCTTTTATGGTTCAGAATATGTCTAAAGTTTTAAAGCTTTATGAAAAA
GATCTACTTGCTATGAATCCACACTTTTTAGTTGAAATGATAAGAATGTAGAATGATCAA
ATAATTTCTTATAATTTATGA