Identifiers and Description

Gene Model Identifier

TTHERM_00471980

Standard Name

None

Aliases

PreTt22606 | 56.m00310 | 3686.m00153

Description

Cyclic nucleotide-gated olfactory channel

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00471980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11248.19.997093137033517e-262hypothetical protein (1787 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00471980(coding)
ATGGGAAACGAATAGTCAAATAATAAGTATAGAAGAGATGCAAACAACTTCAACTAGCAA
AAGTCTAAGATTTAAAATTAAGATTTAGACAACTCAATACTGAGTACTAGTGTTTATTAG
AGGAAAAAATAAGCTTAGCCACATCAGTTAATGTTTTAACCAGTAGACAAAAATGAAATG
AATATTTCAAGAAGAAATTAATTAGATGTATCTCAATCTAGAGTAAATAGAAATAAATCT
TCAAATTTGAGAAACCAAGTTTCTTTTGAAGATGTAGAAAATAGAAGTACCATTAGGAGT
GTATCACCTAATAGATCTCATCTTTTAGTTTAAAGCATGAGGGATATAGATAGAAGATCT
TACAGATAAAGAAACAAGGTTCAAAGAGAAGAAAAAATAGATATAGTTAGAAAAACTACA
GATTTCTGTGTTGATGCGTTATTGCAAAATATTGATTATGAAAACAACTCTTATATTAAT
AGTTTACCAAATTTAACTGCAATGGTTTCATCTTAAAATTTAAATGTTGCTGAAAAGTCA
GACGAGAATCTACTAATTAAAAACATTATGAAAAATAAAACAAAAGAAGAGTAGCATTTA
AGATTAAATATGAAGCATGATTATCCTTTTTCGCACGAAGATAAAAATAGGTTTTCAAAG
CAGCACTCGTTTTTTATAGATGAAAAATATGATAAATTTGCTGATAAATAGCTAGAATAA
GCAGCTTCATTAATTAATAGCAAGCCATATTTAATGTAATCTCAATTAAATGTAAATGAG
TCTAACCTAATAACCTTAGATCCATTTAAAAAAGATATAACTATAAGCGAAATAAAAGCC
CCAAACCGATAAACATTCAAGCCTTTAGTAGATACTAGATAAAATGAATTATAAACAAAA
ATTAATATTAAAGATCTTATAACTACAGATTAACAATTGAGTGCTATTAGCTCTAGAAAA
AATGGATAGAGTCCTTTAAATAATCAAATTGCAAGTGGGAATACCTCTCCTTTTTCTAAC
CTTTTCTAAAAAGCAGCATCAACTGAAAAATAGGAAGAAAAGCCTCAATAATAATAAGAA
TACATTTAAATATAGAAGGTTAATGCAGAAGTTTTAGAAGATAAAACTTCTAAATCGCTT
TTATTAAACACTACTTCTAATTATAATTCACAAAAGTTTGAATCACAACTAAAACCTAGC
TATGAATACACTGAACCTGCTCCAATAATTAAGAAAACAATTGAAATTAACGAAAGGATT
ATTGATAACACTCTACCAAATAATCCAAATTATAATAGCCAAATCTACAATTATGATCCT
TCTAATAGAATTCCAGCAGCACCAAAAAATCAATAACCATATTTTGAAAATAAATAGCCA
TCTTAAGTTTAACAGACAGATTATTATTAAAATCAATCTTATATAAATAGAGTTGATTAT
AATTCTTCATAGATTTTACAAGAAAAACCTTTAAGAGCAGGTAGTAATTAAGATTATGAG
AGAGATTAAAACAGTAATCTCAAAAGCAACTAAAATAATTTTTATCCCACCACCCAGAAG
CTGAAAATCAAAGTTAAAAAGGTAGAAATTCCTTAAAATACAGATTCAGAGAAATACGAT
ACAAGTAGTGAGTCTGAAGAAGATTAAGAGTAGTCTAAGAATATCAAAGGAGTGAGATTA
AGAGAATATGAAAAAGAATTGAGTGAGAGAAAGAAAAAATCTAAAAATAACTTAAATTCA
GCAAATTAAAGTTATTTAAATACTTCTCATACAAATATTAACAAAACTGAAAATTCCTTT
TATAATAATTAAAATAGAAGTAACACTCCCTCATATAGAAATACCAACAATAATAATAAT
AATTAGACTACAAATAATAGTTTCATCACTTACTAGCAAGACTTGTCCCCACAGAATGGT
TAGTACACTCCCTACCAATAAAAATATTATACAACTAATTAGGAATAACAATAACCTCCA
TCTCAATTTACTACTTATTAAATTGAGAATAAAAACTATTATTCAAATTAAAATAATATT
ATATAAGATAAAAATAACAATGAATACGATACTGTCAAAAGATCTCGCCTACAACCATAA
CAAAATTATAACACTCCTTATTAAAATAATCAGTAATAAAATTACAATGAAAATCCCAAC
TAACAGCCATTTTACTAACCTTAAAATTTGAACAATTAACCTTAAAATTACAATAAATAA
TCTTAAAACTACAATAACTATACTTAAGCTCCTAGATCACCACATTCTTAGATGGAATAA
CCTCTAAATTATTCTAATAATCAGACAACATATTCACCTTAGTTCTCTTAAAACTATCTT
CCTAATAATAGTAATATTAATTAATTCTAAGAACAGAGAGACTACCCTTAAAAGATGATC
CCTTTTCACTTACCAGATCAAAGAGAAAAGGCTGTTTAACCTTAGAGTTTAACACCAAGA
AATCCAGATAATATAAATAATTATTAAACTTCTACAACTCCTCGCAGCCAAAGATAACCT
ATATTTAGTAATCATAGTAGCAAACAAAATAGCATTTAAATGAGTTATACTTAAACCTAT
CCTGAATATAGCAACTAACAAAATTAACCTAAATAGCCAATTCTAAACAAATAAGCTTAA
AATCCATAAAACTTTGAAAAAATTATTGACATTAAACTTAACGAATCGAGAACTGAAAGG
CGAAATCCTACACCTTCAAACATTATAAATCAATCATATACTCAAAGGGAAAATATCAAC
ACCCCTTCAACTAGCTAAATTTTAAATTAAAGCTATACAAACATAAACTAAAGCTATAAA
AATTAGTACAATAATGAGCATAGAAGTATTACACCTCCTCCTATTTAAAGAAATGAAAAC
CAAACTGAAAAAATAACCACTACAACTACAGTATATTAGCATGGCTTGGAACCAAATAGA
AGCTTTAATAATAACTATAATAATTATGGACAAAAAGATTACTATTATTAAAAAGAAAAC
TAAAAAGTAAATTGCTAAACATAACCTATTAATGATATAGCACCTTAGTAACCTTACTAA
ACGGAAAAACAAAGTTACTCAACCTATAATTAGCCTCCTACCAAAGTTTAAAATATATAA
AGCTCTATTACAAATACAAAGTAGACTTAATAAAACATATCTTATTCAAGATAAAATCAG
CCTCAAGAGGGTGATGGAACAAATATATTTATTGTGGACTCTCCTCCTTAATCATAGAAA
GAAATAGCATTGAAGAGAAGTTTAAATAATTCACGTGCTTCTTCTAAAAATAAAAAAAGA
AAAAAAACTCCTGGTAGAAAGTAAAATTATTAGAGAAGTGATAATTCAAGTGAAGACCAT
TCACCTAATTCATCAATATATTATGAAGAAAATTAAAATATTTCTGATGATGATTTAAGA
GATAGTTATAGAAATCGCTAACCTTAGGTATAGAGAAAAAGTTAAAAGAATACGAGCTAT
AGTCATGAACGTCAATCACGAAAAAGCAACTAAGACAAAGTGTAGAAAAATAGTCAAACA
AGAAATGGTTAACCAATATAACCTTATAATTAGGAGGAGTCAGAAGAAGATTAGTATGAT
TAAAAAACTAAAAAATCTAAATTACCTAAGAGAGATTAAGAATAAAATAGCAACAAATCC
CATCCTTATAGCTAGTCAAAAACTATTCGCACTGATATGGAGTAAATTTAATAAATATTT
TAATCAACATAAGAAGAATAACCTCCATATGATAATTATTATGATAGTAAAACAAAGCAA
CCTTAGAATAATATAAATTAGGAAATAAATTACAATCAAAATACAAATTAAGAAAATAGG
CAAAATCCCTAATATAATCAATCCTCTACAGCTCAGAGATAACCAAATAAAGATCACTAT
AATTAAATGACTTATCAACCAAAGAAAATGATAAATAATAATCATTAACAAAATTATAAT
TAACAAGAAAGTGAGACTGAGGAAGATGATCTACAATAATAACCCTTTCAACAAAATAAC
TTTTACAAATCTCCTAAAGGTCCATCAAGTTAACCACATAGAAATCCATAAAATAATTAA
GAGTATTAGCCTTAAAGCTATCAAAAACAACCAAGATAGGAAAAATAAAACAATTCGAAT
AATAATTAGTAGTAAAATTAATATAATAGAGAATATGAACAAAAATAATAGATATCCAAT
TCTTAACCAAAATACCAAGATTCCAAAATATAACCTAAAAATATTAATAATAATGGATCA
TTAAGGAATAATTAGAATTATAGTAATACATATCGCAACGAAACTGACTCAGAAACCGAT
TCTGGATACCCTCACTAAGAAATTGATAAGCATGTGTATCCTGGAAATAAATCAAATAGT
CAATCGATAATAAAAAAAGACAATAAAAATAATTCTCGAATTCTTCCTCATAATATAAAT
GATAGTCATTTAAGTTAAAATAATAACTTTTAACAAGAGGATTATAACGTAGTATACGAA
ACTCATCCTTTGCAAAAGCAGTAATCAGAAGTTACTTTAAACAAAAATTACTATCAATAA
AATTAGAAGTAAAATACAAGATAATAAAATCCTCATTAAAATAATGATCATACAAATAGT
TAACAGCCTAATTATAATAATGGTAGTAACATTTAATAAAATTTTAGCAACTATCCATAA
AATTAACAGTATTAAAATTATTAATAAGATTAATATGAAAAAAATTAGTTGTCAAAGGTT
AAGTCAGAAAGTAATTTTTTGAGAAACGATAATTTGTAAAATATGTCAAATCCAAAGTAA
ATTAATTAAAATTCTAATTTACCAAAAGTATTATTAAATAGCAAAGTTAAGGTTAAACTG
CCATAAAATCAAAATGGTACGATACCATAACTCAATCAAAGTTAAGGAAAATAAATGTAA
TAAAATGGATAATAGTATTAACATCAAAATCCTAATTAGTAGTAATATGCAAGAAAACCA
TAAAACCATAATATAAATGATGATAGATATGTATAAGACAACTATAACGAAGAATAAGAA
GAAGATGACAATTAAGTTCTTAGAATGACTTTGGATTTAAGTAACTAAAATCATGCAAAC
AACAGAGCTTCTAATACTCTTGATTTAAACGATAATGAATATGAAGAGCCTGTGAAAGTT
TAATTAACTCTAGAAGAAATTATGAAGAGAGATGATAGTGGATTTTTTGAAAACTAAGAT
GATTTGCTGAACTCTGATACTTCTTCGTAGCAAGCAAATTATATTAATGCCTTAAATTAA
AATTTGCAATATCAAAATAAATATATTTTATGA


>TTHERM_00471980(protein)
MGNEQSNNKYRRDANNFNQQKSKIQNQDLDNSILSTSVYQRKKQAQPHQLMFQPVDKNEM
NISRRNQLDVSQSRVNRNKSSNLRNQVSFEDVENRSTIRSVSPNRSHLLVQSMRDIDRRS
YRQRNKVQREEKIDIVRKTTDFCVDALLQNIDYENNSYINSLPNLTAMVSSQNLNVAEKS
DENLLIKNIMKNKTKEEQHLRLNMKHDYPFSHEDKNRFSKQHSFFIDEKYDKFADKQLEQ
AASLINSKPYLMQSQLNVNESNLITLDPFKKDITISEIKAPNRQTFKPLVDTRQNELQTK
INIKDLITTDQQLSAISSRKNGQSPLNNQIASGNTSPFSNLFQKAASTEKQEEKPQQQQE
YIQIQKVNAEVLEDKTSKSLLLNTTSNYNSQKFESQLKPSYEYTEPAPIIKKTIEINERI
IDNTLPNNPNYNSQIYNYDPSNRIPAAPKNQQPYFENKQPSQVQQTDYYQNQSYINRVDY
NSSQILQEKPLRAGSNQDYERDQNSNLKSNQNNFYPTTQKLKIKVKKVEIPQNTDSEKYD
TSSESEEDQEQSKNIKGVRLREYEKELSERKKKSKNNLNSANQSYLNTSHTNINKTENSF
YNNQNRSNTPSYRNTNNNNNNQTTNNSFITYQQDLSPQNGQYTPYQQKYYTTNQEQQQPP
SQFTTYQIENKNYYSNQNNIIQDKNNNEYDTVKRSRLQPQQNYNTPYQNNQQQNYNENPN
QQPFYQPQNLNNQPQNYNKQSQNYNNYTQAPRSPHSQMEQPLNYSNNQTTYSPQFSQNYL
PNNSNINQFQEQRDYPQKMIPFHLPDQREKAVQPQSLTPRNPDNINNYQTSTTPRSQRQP
IFSNHSSKQNSIQMSYTQTYPEYSNQQNQPKQPILNKQAQNPQNFEKIIDIKLNESRTER
RNPTPSNIINQSYTQRENINTPSTSQILNQSYTNINQSYKNQYNNEHRSITPPPIQRNEN
QTEKITTTTTVYQHGLEPNRSFNNNYNNYGQKDYYYQKENQKVNCQTQPINDIAPQQPYQ
TEKQSYSTYNQPPTKVQNIQSSITNTKQTQQNISYSRQNQPQEGDGTNIFIVDSPPQSQK
EIALKRSLNNSRASSKNKKRKKTPGRKQNYQRSDNSSEDHSPNSSIYYEENQNISDDDLR
DSYRNRQPQVQRKSQKNTSYSHERQSRKSNQDKVQKNSQTRNGQPIQPYNQEESEEDQYD
QKTKKSKLPKRDQEQNSNKSHPYSQSKTIRTDMEQIQQIFQSTQEEQPPYDNYYDSKTKQ
PQNNINQEINYNQNTNQENRQNPQYNQSSTAQRQPNKDHYNQMTYQPKKMINNNHQQNYN
QQESETEEDDLQQQPFQQNNFYKSPKGPSSQPHRNPQNNQEYQPQSYQKQPRQEKQNNSN
NNQQQNQYNREYEQKQQISNSQPKYQDSKIQPKNINNNGSLRNNQNYSNTYRNETDSETD
SGYPHQEIDKHVYPGNKSNSQSIIKKDNKNNSRILPHNINDSHLSQNNNFQQEDYNVVYE
THPLQKQQSEVTLNKNYYQQNQKQNTRQQNPHQNNDHTNSQQPNYNNGSNIQQNFSNYPQ
NQQYQNYQQDQYEKNQLSKVKSESNFLRNDNLQNMSNPKQINQNSNLPKVLLNSKVKVKL
PQNQNGTIPQLNQSQGKQMQQNGQQYQHQNPNQQQYARKPQNHNINDDRYVQDNYNEEQE
EDDNQVLRMTLDLSNQNHANNRASNTLDLNDNEYEEPVKVQLTLEEIMKRDDSGFFENQD
DLLNSDTSSQQANYINALNQNLQYQNKYIL


>TTHERM_00471980(gene)
ATGGGAAACGAATAGTCAAATAATAAGTATAGAAGAGATGCAAACAACTTCAACTAGCAA
AAGTCTAAGATTTAAAATTAAGATTTAGACAACTCAATACTGAGTACTAGTGTTTATTAG
AGGAAAAAATAAGCTTAGCCACATCAGTTAATGTTTTAACCAGTAGACAAAAATGAAATG
AATATTTCAAGAAGAAATTAATTAGATGTATCTCAATCTAGAGTAAATAGAAATAAATCT
TCAAAGTAAAAACATTTTTTTAGATTAATGCAAATAAAGACTGACTGTTTTGAGGAAAAG
GAAATTAATTTTATACCTTTAGCTTTAAAAATAAATTTAAGTTTAAATAAATACTCTAAA
ATATCTTTAAGTCTTTTAATTTTTTTCTCTTTTTAACATATCTACTATAAAAGAATTTTT
TTACAAAATCAAACAAACGCTCTAAACAAAAATTTTTGTTAAACTATTACAAATACTTTA
AAAAGATAATATTGATATTTTTTGGTGAAGTGATAATAAAATTATTATATTTTTTTATAA
TCAACACTTTTACTTTCGTAGTTTTAATTATTCACTAATTTTACTAAAGTTTGAGAAACC
AAGTTTCTTTTGAAGATGTAGAAAATAGAAGTACCATTAGGAGTGTATCACCTAATAGAT
CTCATCTTTTAGTTTAAAGCATGAGGGATATAGATAGAAGATCTTACAGATAAAGAAACA
AGGTTCAAAGAGAAGAAAAAATAGATATAGTTAGAAAAACTACAGATTTCTGTGTTGATG
CGTTATTGCAAAATATTGATTATGAAAACAACTCTTATATTAATAGTTTACCAAATTTAA
CTGCAATGGTTTCATCTTAAAATTTAAATGTTGCTGAAAAGTCAGACGAGAATCTACTAA
TTAAAAACATTATGAAAAATAAAACAAAAGAAGAGTAGCATTTAAGATTAAATATGAAGC
ATGATTATCCTTTTTCGCACGAAGATAAAAATAGGTTTTCAAAGCAGCACTCGTTTTTTA
TAGATGAAAAATATGATAAATTTGCTGATAAATAGCTAGAATAAGCAGCTTCATTAATTA
ATAGCAAGCCATATTTAATGTAAATTGATATTTATTGAACAAATTAAAAACATTTTTTGT
ATAATTTTTAGGTAATCTCAATTAAATGTAAATGAGTCTAACCTAATAACCTTAGATCCA
TTTAAAAAAGATATAACTATAAGCGAAATAAAAGCCCCAAACCGATAAACATTCAAGCCT
TTAGTAGATACTAGATAAAATGAATTATAAACAAAAATTAATATTAAAGATCTTATAACT
ACAGATTAACAATTGAGTGCTATTAGCTCTAGAAAAAATGGATAGAGTCCTTTAAATAAT
CAAATTGCAAGTGGGAATACCTCTCCTTTTTCTAACCTTTTCTAAAAAGCAGCATCAACT
GAAAAATAGGAAGAAAAGCCTCAATAATAATAAGAATACATTTAAATATAGAAGGTTAAT
GCAGAAGTTTTAGAAGATAAAACTTCTAAATCGCTTTTATTAAACACTACTTCTAATTAT
AATTCACAAAAGTTTGAATCACAACTAAAACCTAGCTATGAATACACTGAACCTGCTCCA
ATAATTAAGAAAACAATTGAAATTAACGAAAGGATTATTGATAACACTCTACCAAATAAT
CCAAATTATAATAGCCAAATCTACAATTATGATCCTTCTAATAGAATTCCAGCAGCACCA
AAAAATCAATAACCATATTTTGAAAATAAATAGCCATCTTAAGTTTAACAGACAGATTAT
TATTAAAATCAATCTTATATAAATAGAGTTGATTATAATTCTTCATAGATTTTACAAGAA
AAACCTTTAAGAGCAGGTAGTAATTAAGATTATGAGAGAGATTAAAACAGTAATCTCAAA
AGCAACTAAAATAATTTTTATCCCACCACCCAGAAGCTGAAAATCAAAGTTAAAAAGGTA
GAAATTCCTTAAAATACAGATTCAGAGAAATACGATACAAGTAGTGAGTCTGAAGAAGAT
TAAGAGTAGTCTAAGAATATCAAAGGAGTGAGATTAAGAGAATATGAAAAAGAATTGAGT
GAGAGAAAGAAAAAATCTAAAAATAACTTAAATTCAGCAAATTAAAGTTATTTAAATACT
TCTCATACAAATATTAACAAAACTGAAAATTCCTTTTATAATAATTAAAATAGAAGTAAC
ACTCCCTCATATAGAAATACCAACAATAATAATAATAATTAGACTACAAATAATAGTTTC
ATCACTTACTAGCAAGACTTGTCCCCACAGAATGGTTAGTACACTCCCTACCAATAAAAA
TATTATACAACTAATTAGGAATAACAATAACCTCCATCTCAATTTACTACTTATTAAATT
GAGAATAAAAACTATTATTCAAATTAAAATAATATTATATAAGATAAAAATAACAATGAA
TACGATACTGTCAAAAGATCTCGCCTACAACCATAACAAAATTATAACACTCCTTATTAA
AATAATCAGTAATAAAATTACAATGAAAATCCCAACTAACAGCCATTTTACTAACCTTAA
AATTTGAACAATTAACCTTAAAATTACAATAAATAATCTTAAAACTACAATAACTATACT
TAAGCTCCTAGATCACCACATTCTTAGATGGAATAACCTCTAAATTATTCTAATAATCAG
ACAACATATTCACCTTAGTTCTCTTAAAACTATCTTCCTAATAATAGTAATATTAATTAA
TTCTAAGAACAGAGAGACTACCCTTAAAAGATGATCCCTTTTCACTTACCAGATCAAAGA
GAAAAGGCTGTTTAACCTTAGAGTTTAACACCAAGAAATCCAGATAATATAAATAATTAT
TAAACTTCTACAACTCCTCGCAGCCAAAGATAACCTATATTTAGTAATCATAGTAGCAAA
CAAAATAGCATTTAAATGAGTTATACTTAAACCTATCCTGAATATAGCAACTAACAAAAT
TAACCTAAATAGCCAATTCTAAACAAATAAGCTTAAAATCCATAAAACTTTGAAAAAATT
ATTGACATTAAACTTAACGAATCGAGAACTGAAAGGCGAAATCCTACACCTTCAAACATT
ATAAATCAATCATATACTCAAAGGGAAAATATCAACACCCCTTCAACTAGCTAAATTTTA
AATTAAAGCTATACAAACATAAACTAAAGCTATAAAAATTAGTACAATAATGAGCATAGA
AGTATTACACCTCCTCCTATTTAAAGAAATGAAAACCAAACTGAAAAAATAACCACTACA
ACTACAGTATATTAGCATGGCTTGGAACCAAATAGAAGCTTTAATAATAACTATAATAAT
TATGGACAAAAAGATTACTATTATTAAAAAGAAAACTAAAAAGTAAATTGCTAAACATAA
CCTATTAATGATATAGCACCTTAGTAACCTTACTAAACGGAAAAACAAAGTTACTCAACC
TATAATTAGCCTCCTACCAAAGTTTAAAATATATAAAGCTCTATTACAAATACAAAGTAG
ACTTAATAAAACATATCTTATTCAAGATAAAATCAGCCTCAAGAGGGTGATGGAACAAAT
ATATTTATTGTGGTAAGTTTTTATCTTCTTATTTATTCATTTTAAATATTGAAAATAATA
TAAATTTTATTTAAAAAAGGACTCTCCTCCTTAATCATAGAAAGAAATAGCATTGAAGAG
AAGTTTAAATAATTCACGTGCTTCTTCTAAAAATAAAAAAAGAAAAAAAACTCCTGGTAG
AAAGTAAAATTATTAGAGAAGTGATAATTCAAGTGAAGACCATTCACCTAATTCATCAAT
ATATTATGAAGAAAATTAAAATATTTCTGATGATGATTTAAGAGATAGTTATAGAAATCG
CTAACCTTAGGTATAGAGAAAAAGTTAAAAGAATACGAGCTATAGTCATGAACGTCAATC
ACGAAAAAGCAACTAAGACAAAGTGTAGAAAAATAGTCAAACAAGAAATGGTTAACCAAT
ATAACCTTATAATTAGGAGGAGTCAGAAGAAGATTAGTATGATTAAAAAACTAAAAAATC
TAAATTACCTAAGAGAGATTAAGAATAAAATAGCAACAAATCCCATCCTTATAGCTAGTC
AAAAACTATTCGCACTGATATGGAGTAAATTTAATAAATATTTTAATCAACATAAGAAGA
ATAACCTCCATATGATAATTATTATGATAGTAAAACAAAGCAACCTTAGAATAATATAAA
TTAGGAAATAAATTACAATCAAAATACAAATTAAGAAAATAGGCAAAATCCCTAATATAA
TCAATCCTCTACAGCTCAGAGATAACCAAATAAAGATCACTATAATTAAATGACTTATCA
ACCAAAGAAAATGATAAATAATAATCATTAACAAAATTATAATTAACAAGAAAGTGAGAC
TGAGGAAGATGATCTACAATAATAACCCTTTCAACAAAATAACTTTTACAAATCTCCTAA
AGGTCCATCAAGTTAACCACATAGAAATCCATAAAATAATTAAGAGTATTAGCCTTAAAG
CTATCAAAAACAACCAAGATAGGAAAAATAAAACAATTCGAATAATAATTAGTAGTAAAA
TTAATATAATAGAGAATATGAACAAAAATAATAGATATCCAATTCTTAACCAAAATACCA
AGATTCCAAAATATAACCTAAAAATATTAATAATAATGGATCATTAAGGAATAATTAGAA
TTATAGTAATACATATCGCAACGAAACTGACTCAGAAACCGATTCTGGATACCCTCACTA
AGAAATTGATAAGCATGTGTATCCTGGAAATAAATCAAATAGTCAATCGATAATAAAAAA
AGACAATAAAAATAATTCTCGAATTCTTCCTCATAATATAAATGATAGTCATTTAAGTTA
AAATAATAACTTTTAACAAGAGGATTATAACGTAGTATACGAAACTCATCCTTTGCAAAA
GCAGTAATCAGAAGTTACTTTAAACAAAAATTACTATCAATAAAATTAGAAGTAAAATAC
AAGATAATAAAATCCTCATTAAAATAATGATCATACAAATAGTTAACAGCCTAATTATAA
TAATGGTAGTAACATTTAATAAAATTTTAGCAACTATCCATAAAATTAACAGTATTAAAA
TTATTAATAAGATTAATATGAAAAAAATTAGTTGTCAAAGGTTAAGTCAGAAAGTAATTT
TTTGAGAAACGATAATTTGTAAAATATGTCAAATCCAAAGTAAATTAATTAAAATTCTAA
TTTACCAAAAGTATTATTAAATAGCAAAGTTAAGGTTAAACTGCCATAAAATCAAAATGG
TACGATACCATAACTCAATCAAAGTTAAGGAAAATAAATGTAATAAAATGGATAATAGTA
TTAACATCAAAATCCTAATTAGTAGTAATATGCAAGAAAACCATAAAACCATAATATAAA
TGATGATAGATATGTATAAGACAACTATAACGAAGAATAAGAAGAAGATGACAATTAAGT
TCTTAGAATGACTTTGGATTTAAGTAACTAAAATCATGCAAACAACAGAGCTTCTAATAC
TCTTGATTTAAACGATAATGAATATGAAGAGCCTGTGAAAGTTTAATTAACTCTAGAAGA
AATTATGAAGAGAGATGATAGTGGATTTTTTGAAAACTAAGATGATTTGCTGAACTCTGA
TACTTCTTCGTAGCAAGCAAATTATATTAATGCCTTAAATTAAAATTTGCAATATCAAAA
TAAATATATTTTATGA