Identifiers and Description

Gene Model Identifier

TTHERM_00471350

Standard Name

None

Aliases

PreTt22546 | 56.m00250 | 3686.m00093

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00471350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11306.14.0017545581927916e-85hypothetical protein (128 aa)
SGDYNL153C0.000000000000004001928599951003GIM3 Subunit of the heterohexa
meric cochaperone prefoldin co
mplex which binds specifically
to cytosolic chaperonin and t
ransfers target proteins to it
WormBaseWBGene000071070.00000000000020009182674645818locus:pfd-4 Probable prefold
in subunit 4 status:Confirme
d UniProt:Q17435 protein_i
d:CAA97410.1
DictyBaseDDB_G02818730.0000000000010000211161514907pfdn4 on chromosome: 3 positio
n 5055049 to 5055612
OxytrichaContig3736.0.0.g900.000000030002053728821195Prefoldin subunit

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00471350(coding)
ATGGCTTCAAAGATCTAAAGTGATATTGAAATAACTAAAGATGACTAAAACTAAATTAAC
TAATTTAGTCGTATAAACATGCACTGGAATGAAAAAAATAGAACCATGCAAAAGAAAAAC
GAAATTTTAAACTAACTTGATGATGCTGCTACTGAATTAGAGTTATGCGATGATGAAGAA
ACAGTATAAGTAAAGTATGGTGATTGCTTCTTCCATGTTAAGGTAGAATAGGCAAAATAA
TATGTTGAAGAATAATAAACTTAAACAAAGAAAGAAACAAACGAAATATCTAAGGTTATG
GATGAATAAGAAAAGAAAATGAAAAAACTCAAGGCAGTTTTGTACACTAAATTTGGTAAT
TAGATCAACCTTGAAGAAGATTGA


>TTHERM_00471350(protein)
MASKIQSDIEITKDDQNQINQFSRINMHWNEKNRTMQKKNEILNQLDDAATELELCDDEE
TVQVKYGDCFFHVKVEQAKQYVEEQQTQTKKETNEISKVMDEQEKKMKKLKAVLYTKFGN
QINLEED


>TTHERM_00471350(gene)
TTTACTCAAAATAATGCAGGAAGATAAGAAGTAAATAATAAAAATTAGATAAATTACAAA
AATTTAAAAATAAATATAAATATTAAACTTTATCAAAAATCAAAAATTTTTGAATAAAAA
ACTCAAATCAAATCAAATTAAATTAAATATTAATTATTTGTGATTTTCAATCATAAAATT
ATTAAAAAAAAGATACATTATTTTTATTATTCACATAAATTTCAAATAAAGTAGCAAAAA
TTTACTAAAATGGCTTCAAAGATCTAAAGTGATATTGAAATAACTAAAGATGACTAAAAC
TAAATTAACTAATTTAGTCGTATAAACATGCACTGGAATGAAAAAAATAGAACCATGCAA
AAGAAAAACGAAATTTTAAACTAACTTGATGATGCTGCTACTGAATTAGAGTTATGCGAT
GATGAAGAAACAGTATAAGTAAAGTATGGTGATTGCTTCTTCCATGTTAAGGTAGAATAG
GCAAAATAATATGTTGAAGAATAATAAACTTAAACAAAGAAAGAAACAAACGAAATATCT
AAGGTTATGGATGAATAAGAAAAGAAAATGAAAAAACTCAAGGCAGTTTTGTACACTAAA
TTTGGTAATTAGATCAACCTTGAAGAAGATTGA