Identifiers and Description

Gene Model Identifier

TTHERM_00467540

Standard Name

None

Aliases

PreTt18656 | 55.m00211 | 3710.m00060

Description

G-patch domain protein; G-patch domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF01585 ) G-patch domain
  • ( PF08697 ) Tuftelin interacting protein 11

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00467540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15740.19.997093137033517e-262G-patch domain-containing prot
ein (1073 aa)
WormBaseWBGene000074123.0000451088882257e-25locus:stip-1 Septin and tuft
elin-interacting protein 1 hom
olog status:Confirmed UniP
rot:Q17784 protein_id:CAA900
93.2
DictyBaseDDB_G02740355.002171138422328e-22stip-2 on chromosome: 2 positi
on 3693611 to 3696390
OxytrichaContig621.0.g490.000000000000020000882446601127GC-rich sequence DNA-binding f
actor-like protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00467540(coding)
ATGAGCTACTAGAAAGACTATAATACTACAGGTTTTAATATGGATGATGAATTTGGCTCT
CATATTGATGAAAACGGTTTTATTTCATTCACTAAATAAAAACCTAAAAAACTATCAAAG
GAAGATTAGATATATGGAATTTGGAATTAAGAAGTTGAAGAAAGTGTATTTAAAGGATCA
AAGCAATTAGCAAAAACCACATTAGCTATGAATTTCAGGAAGAGTGGGTTGTACGAACAT
AATTCAGAAACAGGTATTAAATTGTAATAGTAGTAGAGATTTGAGGATGGCTTCGATCCT
CTTTTGTATGATGTTGAAATATAAGAAGAGGATGAAGAGGAAGAAGAGAAGAGCGATAAT
GAAGAAGACAAATTTAGTCATTAAAATCTGTACCACTAAAAAAACAAGCAAAATTACAAG
CAAATGTTTTAGAGAGGAGGAAGAATTTCAAAGAATGATGAAGACGATGAAAATGACTTT
AGAGAAAGGGAAGAATATGAGGAAGAAGATGAAGATAATGACGATGATGATGTTGAAGGC
TTTTAAAGAAAAAACAAGAATAAGCTTTTCTTTAAATCTACTTCATCAAAAAAATAAGAA
AAGAATAAACTGAAATCTATTTTAAAATAGAAGAATAGTAACTAGTAACAAGGAAATGAT
TTTGATAATGATTTGCAAGATTTAGACGAATTAGGTGATGGTAGTGGTGAAGAAAATAAT
GATTAAGAGATTGATGATGAGGATGCTTATGAAGATCAAGATGAAAAATTCTAATTTAAA
AAAGCTTCTAAATCATCTTAGATTCATCTAACAAAAGAATAAATGAGAAAGAAGAAAATA
TTTAATTTTAAAAGGAATAAAGAAGATGATGAAGATGCTATTTTTGAAGAATAAACTTAG
CAATTCAACTTACCTCTGAGATTTGGGTAGCAAAGAAAATAATTCAAAAAGAAAACTGAT
TAAGAAATAGAAGAGGAGTCTAAGGCTATAGTAAATTTGGAAACATAATAGGAAATGATT
GAAGCTAAAATGCACAAAGAAAATTATGGAAAAGGTTTTGATATGCTTTAAAAAATGGGT
TTTAAACTTGGAAAAGGTATTGGTAAAGAAGAGCAAGGTCGTGCAAAACCTGTTGAAGCT
TAATTCAAACAGAGTTTTACAATGTAAGACAATTACAAGCAAATGGAAGCTGAGAATAAG
AAGCTGCTTAAAGAATATGGTATTGATGTAGAAGCAGAAATAGACGAGTTCGAAACAGCT
TATAGTGAATTTAAAAAGAATCAGTCAGAATTTGGAGATTACGATGATGAGAATACTATT
GAGTTTGAAAAAACTTATGTTAAAAGAAATGACGAGAATAAGCGTTTCCCCAACCGCTTT
TTCGCTCACTTAAATAAAAAGAGCAAGCAAGCAAAGCAAGGTAGTATGACAGATATCGGG
GATTCAAATATTAAAAGTGATAATTCATTACCAGGTTCTTCTAATTTTTCTGGTGTATAA
AGTATGAAAATTATAGATATGAGAGGCGATAGCTCTGTGACTTATGATGGCGCAAAAGGA
GATGCTTATACTAATTTCTTTGCTGCTAGTAAAATTTTAGATAGCAAATCCTTAGCTAAG
CAAGAAAATCCAATATTTTCAGAAATGCTCTATAACTTAAAGAATAAATTAGATAAATCT
AAAGGAAAGAAAATGAATTTATCCTCAAAAATTAAAACAGAATCCGATCGTATAGTTACA
GTTTAATACGAAGAATAGTAGTTAACAGAGAAGCAAAATAGCCATAAAAAAGTTATGAAT
CAAACAGTAACTCTTTTGAATAATCTTTAATAAATGAGATAAGATGAAAATAATCTGAAC
GGTGATGATGTTTATAAGCACTTCAAAGAAATGTTTGAAAACTGTGGAGAACAATTTATT
CATTACAATTTAGAATAACTTTTAGTCAAATAGATCACTCAAAGTTTAAAAATATAATTT
TAGAACTCAATTTATAAACAAAATCTTAAATCTTAGTCAAATAATATCGAAACTGAAGTA
GAAGAAGAAGAATAAGAAATTAGTTTATAGAAAACAACAGAAGACTTTGGCTACGACATT
GAGGGATCAAGCATAAAAAACAAGTCTATTCTTTAACAATCTTAAGACTTTTAAATTATG
TAGTTTGATTAAACTGAAATAAAAAAATCTGTTTAGCTCATTTAATAAGTTGAAAAGCTT
TTAACTAAAATATTCTTATTTAAGCAAAACTCAAATTTACACAGATACGAAAGTGAGTTA
TCAGGAAATATTTATTTGTAGAGAGACACAAATTTGAATGAAAAAAATGAGAGAATCATA
TAGAGATATATTTAATTTATAATTAACCACTCATTTATGCCTCATTTAAAGAATTTCATG
ATAAAATAATTTAATCCTACTAACTTAAGAAGTAATAATTAAATCATAGATTGCCTTGAG
GAGTACTAAAAAGTTCTCCCCAAAGCAGTTATTTCTGATCTAGTATAAAGTTTCATCTTG
CCTAAATTAAATGATGCTGTTAAAAAGTGGCATCCTTCTACAAAGGCAGAAGGCAAGAAC
ACTTAAGCGGATGTAGATTTATGGCTCATCCCCTGGATTACAATTATTTCTCCTATTGAT
CTTCTGAAAGACACCTTTAAACTAGTGCTAGCTAAATACTCTTAGGTTTTATCCAAATGG
GAAATTTAAGATAAAAGCATGTTTGAAAAGTTAAAACCCTGGAAACAGATTATATCTGAA
TCTTAATGGAACGATTTAATGCTTAAGCAGATAATTCCTAAATTATAATTTTATTTAGAC
TAACTTGAGATAAATCCAAGTGAATAAAAGGATTTAGATGTAATTGAGAATATAGTATTA
TGGTGCGATCTAATTTAACCTAAAGATGTTACTAGCATAATGGAAGACACTTTATTAGTC
AAATTGGCTGAAGTTCTAATGGAGTGGTTATCTAGTGAGGGAGCAGAAAAGTAAGAAATA
AAATCTTGGCTTTAAAGCTGGGAGTCACTTCTTGGAGATAAAATTATGGAAATAGAAATC
TTTTAGGATACATTCAACTAGTTCTTTTTAAAATTAGATGAATTAAATTGA


>TTHERM_00467540(protein)
MSYQKDYNTTGFNMDDEFGSHIDENGFISFTKQKPKKLSKEDQIYGIWNQEVEESVFKGS
KQLAKTTLAMNFRKSGLYEHNSETGIKLQQQQRFEDGFDPLLYDVEIQEEDEEEEEKSDN
EEDKFSHQNLYHQKNKQNYKQMFQRGGRISKNDEDDENDFREREEYEEEDEDNDDDDVEG
FQRKNKNKLFFKSTSSKKQEKNKLKSILKQKNSNQQQGNDFDNDLQDLDELGDGSGEENN
DQEIDDEDAYEDQDEKFQFKKASKSSQIHLTKEQMRKKKIFNFKRNKEDDEDAIFEEQTQ
QFNLPLRFGQQRKQFKKKTDQEIEEESKAIVNLETQQEMIEAKMHKENYGKGFDMLQKMG
FKLGKGIGKEEQGRAKPVEAQFKQSFTMQDNYKQMEAENKKLLKEYGIDVEAEIDEFETA
YSEFKKNQSEFGDYDDENTIEFEKTYVKRNDENKRFPNRFFAHLNKKSKQAKQGSMTDIG
DSNIKSDNSLPGSSNFSGVQSMKIIDMRGDSSVTYDGAKGDAYTNFFAASKILDSKSLAK
QENPIFSEMLYNLKNKLDKSKGKKMNLSSKIKTESDRIVTVQYEEQQLTEKQNSHKKVMN
QTVTLLNNLQQMRQDENNLNGDDVYKHFKEMFENCGEQFIHYNLEQLLVKQITQSLKIQF
QNSIYKQNLKSQSNNIETEVEEEEQEISLQKTTEDFGYDIEGSSIKNKSILQQSQDFQIM
QFDQTEIKKSVQLIQQVEKLLTKIFLFKQNSNLHRYESELSGNIYLQRDTNLNEKNERII
QRYIQFIINHSFMPHLKNFMIKQFNPTNLRSNNQIIDCLEEYQKVLPKAVISDLVQSFIL
PKLNDAVKKWHPSTKAEGKNTQADVDLWLIPWITIISPIDLLKDTFKLVLAKYSQVLSKW
EIQDKSMFEKLKPWKQIISESQWNDLMLKQIIPKLQFYLDQLEINPSEQKDLDVIENIVL
WCDLIQPKDVTSIMEDTLLVKLAEVLMEWLSSEGAEKQEIKSWLQSWESLLGDKIMEIEI
FQDTFNQFFLKLDELN


>TTHERM_00467540(gene)
ATGAATTTGTGTCTACAAATAGAAATATTAATATTGAGTATATTGATAATAAAAATTATA
GTTTATCAATAATTTATCTTTAATTAAATTGAAGGAGTAATTCTTGCAATTCAAAAAGAA
AAATAAGTTTTCAAAAGAGTTAAAATAATGAGCTACTAGAAAGACTATAATACTACAGGT
TTTAATATGGATGATGAATTTGGCTCTCATATTGATGAAAACGGTTTTATTTCATTCACT
AAATAAAAACCTAAAAAACTATCAAAGGAAGATTAGATATATGGAATTTGGAATTAAGAA
GTTGAAGAAAGTGTATTTAAAGGATCAAAGCAATTAGCAAAAACCACATTAGCTATGAAT
TTCAGGAAGAGTGGGTTGTACGAACATAATTCAGAAACAGGTATTAAAGTAAAATATGCT
AATCAGTAACAGTCATCAACTGTATAGAAAGAAGATCAGTAATCTAAGAAATCGAACGAT
ATAAAATAAAATACTGATAATTAAAAAAAGGTATCTAAATAGAAAAAGTCTGTGAAATTT
GATGAAGTAAATTTATAAGAAAATGAATTATTAAAAAAAAAGAAATAGTTGTAATAGTAG
TAGAGATTTGAGGATGGCTTCGATCCTCTTTTGTATGATGTTGAAATATAAGAAGAGGAT
GAAGAGGAAGAAGAGAAGAGCGATAATGAAGAAGACAAATTTAGTCATTAAAATCTGTAC
CACTAAAAAAACAAGCAAAATTACAAGCAAATGTTTTAGAGAGGAGGAAGAATTTCAAAG
AATGATGAAGACGATGAAAATGACTTTAGAGAAAGGGAAGAATATGAGGAAGAAGATGAA
GATAATGACGATGATGATGTTGAAGGCTTTTAAAGAAAAAACAAGAATAAGCTTTTCTTT
AAATCTACTTCATCAAAAAAATAAGAAAAGAATAAACTGAAATCTATTTTAAAATAGAAG
AATAGTAACTAGTAACAAGGAAATGATTTTGATAATGATTTGCAAGATTTAGACGAATTA
GGTGATGGTAGTGGTGAAGAAAATAATGATTAAGAGATTGATGATGAGGATGCTTATGAA
GATCAAGATGAAAAATTCTAATTTAAAAAAGCTTCTAAATCATCTTAGATTCATCTAACA
AAAGAATAAATGAGAAAGAAGAAAATATTTAATTTTAAAAGGAATAAAGAAGATGATGAA
GATGCTATTTTTGAAGAATAAACTTAGCAATTCAACTTACCTCTGAGATTTGGGTAGCAA
AGAAAATAATTCAAAAAGAAAACTGATTAAGAAATAGAAGAGGAGTCTAAGGCTATAGTA
AATTTGGAAACATAATAGGAAATGATTGAAGCTAAAATGCACAAAGAAAATTATGGAAAA
GGTTTTGATATGCTTTAAAAAATGGGTTTTAAACTTGGAAAAGGTATTGGTAAAGAAGAG
CAAGGTCGTGCAAAACCTGTTGAAGCTTAATTCAAACAGAGTTTTACAATGTAAGACAAT
TACAAGCAAATGGAAGCTGAGAATAAGAAGCTGCTTAAAGAATATGGTATTGATGTAGAA
GCAGAAATAGACGAGTTCGAAACAGCTTATAGTGAATTTAAAAAGAATCAGTCAGAATTT
GGAGATTACGATGATGAGAATACTATTGAGTTTGAAAAAACTTATGTTAAAAGAAATGAC
GAGAATAAGCGTTTCCCCAACCGCTTTTTCGCTCACTTAAATAAAAAGAGCAAGCAAGCA
AAGCAAGGTAGTATGACAGATATCGGGGATTCAAATATTAAAAGTGATAATTCATTACCA
GGTTCTTCTAATTTTTCTGGTGTATAAAGTATGAAAATTATAGATATGAGAGGCGATAGC
TCTGTGACTTATGATGGCGCAAAAGGAGATGCTTATACTAATTTCTTTGCTGCTAGTAAA
ATTTTAGATAGCAAATCCTTAGCTAAGCAAGAAAATCCAATATTTTCAGAAATGCTCTAT
AACTTAAAGAATAAATTAGATAAATCTAAAGGAAAGAAAATGAATTTATCCTCAAAAATT
AAAACAGAATCCGATCGTATAGTTACAGTTTAATACGAAGAATAGTAGTTAACAGAGAAG
CAAAATAGCCATAAAAAAGTTATGAATCAAACAGTAACTCTTTTGAATAATCTTTAATAA
ATGAGATAAGATGAAAATAATCTGAACGGTGATGATGTTTATAAGCACTTCAAAGAAATG
TTTGAAAACTGTGGAGAACAATTTATTCATTACAATTTAGAATAACTTTTAGTCAAATAG
ATCACTCAAAGTTTAAAAATATAATTTTAGAACTCAATTTATAAACAAAATCTTAAATCT
TAGTCAAATAATATCGAAACTGAAGTAGAAGAAGAAGAATAAGAAATTAGTTTATAGAAA
ACAACAGAAGACTTTGGCTACGACATTGAGGGATCAAGCATAAAAAACAAGTCTATTCTT
TAACAATCTTAAGACTTTTAAATTATGTAGTTTGATTAAACTGAAATAAAAAAATCTGTT
TAGCTCATTTAATAAGTTGAAAAGCTTTTAACTAAAATATTCTTATTTAAGCAAAACTCA
AATTTACACAGATACGAAAGTGAGTTATCAGGAAATATTTATTTGTAGAGAGACACAAAT
TTGAATGAAAAAAATGAGAGAATCATATAGAGATATATTTAATTTATAATTAACCACTCA
TTTATGCCTCATTTAAAGAATTTCATGATAAAATAATTTAATCCTACTAACTTAAGAAGT
AATAATTAAATCATAGATTGCCTTGAGGAGTACTAAAAAGTTCTCCCCAAAGCAGTTATT
TCTGATCTAGTATAAAGTTTCATCTTGCCTAAATTAAATGATGCTGTTAAAAAGTGGCAT
CCTTCTACAAAGGCAGAAGGCAAGAACACTTAAGCGGATGTAGATTTATGGCTCATCCCC
TGGATTACAATTATTTCTCCTATTGATCTTCTGAAAGACACCTTTAAACTAGTGCTAGCT
AAATACTCTTAGGTTTTATCCAAATGGGAAATTTAAGATAAAAGCATGTTTGAAAAGTTA
AAACCCTGGAAACAGATTATATCTGAATCTTAATGGAACGATTTAATGCTTAAGCAGATA
ATTCCTAAATTATAATTTTATTTAGACTAACTTGAGATAAATCCAAGTGAATAAAAGGAT
TTAGATGTAATTGAGAATATAGTATTATGGTGCGATCTAATTTAACCTAAAGATGTTACT
AGCATAATGGAAGACACTTTATTAGTCAAATTGGCTGAAGTTCTAATGGAGTGGTTATCT
AGTGAGGGAGCAGAAAAGTAAGAAATAAAATCTTGGCTTTAAAGCTGGGAGTCACTTCTT
GGAGATAAAATTATGGAAATAGAAATCTTTTAGGATACATTCAACTAGTTCTTTTTAAAA
TTAGATGAATTAAATTGA