Identifiers and Description

Gene Model Identifier

TTHERM_00463030

Standard Name

None

Aliases

PreTt25755 | 54.m00211 | 3823.m01124

Description

C2H2-type zinc-finger protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00463030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10742.19.997093137033517e-262zinc finger, C2H2 type family
protein (1099 aa)
WormBaseWBGene000039094.997543945741262e-17locus:pag-3 status:Confirmed
UniProt:G5EDE1 protein_id
:CAB05729.2
OxytrichaContig13451.0.g24.997543945741262e-17Zinc-finger double domain
DictyBaseDDB_G02810852.0004286606204839e-16tfiiiA on chromosome: 3 positi
on 4032257 to 4033987
SGDYOR113W0.000000000000005001692698841201AZF1 Zinc-finger transcription
factor, involved in induction
of CLN3 transcription in resp
onse to glucose; genetic and p
hysical interactions indicate
a possible role in mitochondri
al transcription or genome mai
ntenance

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00463030(coding)
ATGTCATTCAAATGTGAATAATGCGAGCGTGTTTTCGCCAAAAAAAGCAAGCTTAACCGT
CATGTTCGTGAAACTCATATGAACATCAAGCAATACGTTTGTGAAGAGTGTGGAAAGAAT
TTCAAGAGAAACTCACACTTAAAGCGCCATTTAATCTCTCACAGTGAGAATCCTAAGCCA
CACAAGTGTAGCTACGAAGGATGCTACATGGCTTTCACTTGCAAGCATCATTTAGAGAGG
CACATCAAGATTATTCATATAGAAGAATACTAGTATAAATGTACTGAATGTGATGCTAAG
TTTCCTAAGAAGGTTTCTCTAAATAAGCATCTTACCTATGATCACGGTAAAAAGAAGCCT
CTAACTTGTCAGCTATGCCATAAATCTTTCTTCAAACTTGGACAACTTGAATACCATCAC
TGCGAAGAAAAGTTTAAGTAACTAAATTTGGAATTAGAAAATGTAGGAGCAAACCCTAAT
ATGATGTAAGATTTAAATGTAAATGATCTTTCTGATAATTAGAATCATGCTGAAAGATCT
TAGGGAAAAAGCAATTTAAATAACATTGAAGCGTTTTAGCAAGGATTAGTTAATGAAGAT
AGTATGTTCCAAAATTAAATGAACTCTCATCACATTCCTATGCTCCACGATGATCAACAT
CATGAGCCTAATAATATTCCAGTAATTGATATATCTCAATTTTCTAGAAAGCAGCGTTAA
AGAAACTACAATTATGCCAACACAGATTACTCAACAACTTCTATGTCCTAAAATAACAAT
GAATTAAATTAATAGCATGGATCCTCACGCAATGCAAATCAAGGATCTAAGATAAGCGAA
TAAAACATTAATAGCTCTCAATTAAGTGGACCAACTGAGTCTTTGAATACAAACAGTACC
AGCAATATACTTTCAAATCGCATTATGAATAGTAATTCAGCTGTATCTTTAAATAATTAG
ATTCAGCCTCCCATAAAAAAGAAATTTAAACCTGACTATTTAGAAAATTAGAATTTTAGT
TTGAGCGGGGATTAATAACCTATAAGTAATAATATTAATAATAAGTAATAAAACTCAATT
AATGCATCGAGCAGCATTAATGATCAACACAAGTAATCTAAGCAAGAAAATGTTATTAGC
GAATCTGCAGAAGGAGCAAATAGATAAAAGATAATTAAAATATCATTCGATGGCTTAAAC
ACTTAGAGTGATTCTCAAGATCCATACACCTTTAAAGAAAAGAATATTTCCTTCAGTAAC
CCTAGCCTTGGATTGAATTCCTCTAATTAAATTACAGGGTTACTCATGCCTGAAGTTAAT
CTTTAAGCTACTCTAAATGAGTAATAAAAAATCACAGAAGCATTTAACAATAAAGTTCCC
ATCAAAGTAGAGGAACCAGCTGTTGATAAGAAGAAAGAGGGAGTTAAATCAAGCAACGAC
CTCTCAGAATAGCAATAGTAATAATAATAATAGTAGTAACAACTAAGTAATAATTAAGGT
TACTATGAAAACATGCACAATGAAGTAAACCGTGAATACATGCATGACCCAAAACAAGAA
TACGATACTATCAATTTAGACATGAACAACTAAAGTGATATTCATGGAAATTTTGGTAAC
TAAGGAATGCAAAATATTGGGTAGGGCAATCTCTATGAATAGTATTACAAAAGTCCTTCA
CTCAGACCTAACGGTAGAAAGCTTAGTGAATTATTCACAATTCACGATTTTAAAGAACGT
AAAAATAGCTTCAACAGTGATTATGGAAATTTGACTATCTTTAAAGATTTGTTTTAGGAA
AACTCTTTCAATAGTCGTCGTCCTTCAATGAATATCCCCGAATCTAAAAATTATCGTAAA
GGATCAATTTTCCAACTTCAAAAGATGGAAGAAGACGGAATTATGGTTGATCTTGATATG
AATTAAGGAGATTTGAATAATATGATGACTGCTAATTAATCACAAGAAATTCACCACAAC
TTACAAAGTAATTATGATCAAATGAATAGCTAAAGCGCTAATAATAATGCAAATATCAAT
AGTAATGTAGGACTTGAAAGCAATTACGCTAATTAAAGCGATTAAATGATAGGAAACAAC
TCATAGCAATTTATTTAGAACTCGACAATTCTTTCTTAATTAAACAATAATAAGGCTGAA
TAATCAGAAGTCCAATTGAAGACATAACAGCGCATAAATCATCACCACCAAATGCAAAAT
AATAGATTGCAATAACCTATTTAAAAGTAAGGATACACAAGCAACAATCCCTAATTGCAT
CATCACATCTACCAACAAAGAGAAGTCTCTCCCTAAATGCAATTCAATCCTGATTCAGCT
AAGGTAGGATACGCTCACAGTCCCTACATCCCTTTAGTCGTTAGAAGCAAATCTCCTTCT
AACAAAATTAAAAAAGAAGAAAAATGCTACAAATGTAACTACGCAGACTGTGACAAATTT
TATACAAAGCTCTCAAATTTGAAAACTCACATCAGAACCTTCCACTTTAAGAGTAAAGAC
TTTAAATGCAATTATCAAGGTTGTAAATCAGCGTACCTCCACAAGAAGAGCTTAAAAGAG
CATATAGCCCGTGTGCATAAATCTGCTCCTGGCGCTTATATCCCAGGAAGCAAGAGAAAT
TCAGAAGATTATGAATACTCAGACGAACATTAAATGAATCAATTAAACTAGAACCAAATA
AAGGAGATTTTACCAAAAATTTAATACGATGAGCATGATCACTAATAAATTTTATAGTAA
TCTCAATAGTAAATATCATAGCAATAACAGTACCATATTTCTCACCAAAGCCATCATCTC
CAAAATCACCACTAATAAAATTCCGTACAACAAAATGATCTCCTTGCAAACCATTCATCC
ATGTATGGCCTGTACATTCCCTCCCCGAACTCTGCTTCCCAAAATACTACTTCCCAAATA
AATTATCATTAGTAATTCACCCAGTAGCAATAACAATAGCAGTAATAATAATAATAGCAG
TAATTGCATCAGAACTCATTTTCATCTTCCATGCAAAATGCAGCAACAGCAGCAGTAGCA
GCTCCTTTTTACTCCTATTAAAATTAACCTGAATATGTTGTTTAGCATGATGCATAATTG
TAAATACCTCTTCTTTAATCAACTTAATCATAATAATAACAATATTAACCTAACTATCCA
TAACTTCATAGAAATCTCAGTCTCCCTACCCATCACTCTCAATAAACTAAATCGTCAGTC
TTTATGGCTTGA


>TTHERM_00463030(protein)
MSFKCEQCERVFAKKSKLNRHVRETHMNIKQYVCEECGKNFKRNSHLKRHLISHSENPKP
HKCSYEGCYMAFTCKHHLERHIKIIHIEEYQYKCTECDAKFPKKVSLNKHLTYDHGKKKP
LTCQLCHKSFFKLGQLEYHHCEEKFKQLNLELENVGANPNMMQDLNVNDLSDNQNHAERS
QGKSNLNNIEAFQQGLVNEDSMFQNQMNSHHIPMLHDDQHHEPNNIPVIDISQFSRKQRQ
RNYNYANTDYSTTSMSQNNNELNQQHGSSRNANQGSKISEQNINSSQLSGPTESLNTNST
SNILSNRIMNSNSAVSLNNQIQPPIKKKFKPDYLENQNFSLSGDQQPISNNINNKQQNSI
NASSSINDQHKQSKQENVISESAEGANRQKIIKISFDGLNTQSDSQDPYTFKEKNISFSN
PSLGLNSSNQITGLLMPEVNLQATLNEQQKITEAFNNKVPIKVEEPAVDKKKEGVKSSND
LSEQQQQQQQQQQQLSNNQGYYENMHNEVNREYMHDPKQEYDTINLDMNNQSDIHGNFGN
QGMQNIGQGNLYEQYYKSPSLRPNGRKLSELFTIHDFKERKNSFNSDYGNLTIFKDLFQE
NSFNSRRPSMNIPESKNYRKGSIFQLQKMEEDGIMVDLDMNQGDLNNMMTANQSQEIHHN
LQSNYDQMNSQSANNNANINSNVGLESNYANQSDQMIGNNSQQFIQNSTILSQLNNNKAE
QSEVQLKTQQRINHHHQMQNNRLQQPIQKQGYTSNNPQLHHHIYQQREVSPQMQFNPDSA
KVGYAHSPYIPLVVRSKSPSNKIKKEEKCYKCNYADCDKFYTKLSNLKTHIRTFHFKSKD
FKCNYQGCKSAYLHKKSLKEHIARVHKSAPGAYIPGSKRNSEDYEYSDEHQMNQLNQNQI
KEILPKIQYDEHDHQQILQQSQQQISQQQQYHISHQSHHLQNHHQQNSVQQNDLLANHSS
MYGLYIPSPNSASQNTTSQINYHQQFTQQQQQQQQQQQQQQLHQNSFSSSMQNAATAAVA
APFYSYQNQPEYVVQHDAQLQIPLLQSTQSQQQQYQPNYPQLHRNLSLPTHHSQQTKSSV
FMA


>TTHERM_00463030(gene)
ATGTCATTCAAATGTGAATAATGCGAGCGTGTTTTCGCCAAAAAAAGCAAGCTTAACCGT
CATGTTCGTGAAACTCATATGAACATCAAGCAATACGTTTGTGAAGAGTGTGGAAAGAAT
TTCAAGAGAAACTCACACTTAAAGCGCCATTTAATCTCTCACAGTGAGAATCCTAAGCCA
CACAAGTGTAGCTACGAAGGATGCTACATGGCTTTCACTTGCAAGCATCATTTAGAGAGG
CACATCAAGATTATTCATATAGAAGAATACTAGTATAAATGTACTGAATGTGATGCTAAG
TTTCCTAAGAAGGTTTCTCTAAATAAGCATCTTACCTATGATCACGGTAAAAAGAAGCCT
CTAACTTGTCAGCTATGCCATAAATCTTTCTTCAAACTTGGACAACTTGAATACCATCAC
TGCGAAGAAAAGTTTAAGTAACTAAATTTGGAATTAGAAAATGTAGGAGCAAACCCTAAT
ATGATGTAAGATTTAAATGTAAATGATCTTTCTGATAATTAGAATCATGCTGAAAGATCT
TAGGGAAAAAGCAATTTAAATAACATTGAAGCGTTTTAGCAAGGATTAGTTAATGAAGAT
AGTATGTTCCAAAATTAAATGAACTCTCATCACATTCCTATGCTCCACGATGATCAACAT
CATGAGCCTAATAATATTCCAGTAATTGATATATCTCAATTTTCTAGAAAGCAGCGTTAA
AGAAACTACAATTATGCCAACACAGATTACTCAACAACTTCTATGTCCTAAAATAACAAT
GAATTAAATTAATAGCATGGATCCTCACGCAATGCAAATCAAGGATCTAAGATAAGCGAA
TAAAACATTAATAGCTCTCAATTAAGTGGACCAACTGAGTCTTTGAATACAAACAGTACC
AGCAATATACTTTCAAATCGCATTATGAATAGTAATTCAGCTGTATCTTTAAATAATTAG
ATTCAGCCTCCCATAAAAAAGAAATTTAAACCTGACTATTTAGAAAATTAGAATTTTAGT
TTGAGCGGGGATTAATAACCTATAAGTAATAATATTAATAATAAGTAATAAAACTCAATT
AATGCATCGAGCAGCATTAATGATCAACACAAGTAATCTAAGCAAGAAAATGTTATTAGC
GAATCTGCAGAAGGAGCAAATAGATAAAAGATAATTAAAATATCATTCGATGGCTTAAAC
ACTTAGAGTGATTCTCAAGATCCATACACCTTTAAAGAAAAGAATATTTCCTTCAGTAAC
CCTAGCCTTGGATTGAATTCCTCTAATTAAATTACAGGGTTACTCATGCCTGAAGTTAAT
CTTTAAGCTACTCTAAATGAGTAATAAAAAATCACAGAAGCATTTAACAATAAAGTTCCC
ATCAAAGTAGAGGAACCAGCTGTTGATAAGAAGAAAGAGGGAGTTAAATCAAGCAACGAC
CTCTCAGAATAGCAATAGTAATAATAATAATAGTAGTAACAACTAAGTAATAATTAAGGT
TACTATGAAAACATGCACAATGAAGTAAACCGTGAATACATGCATGACCCAAAACAAGAA
TACGATACTATCAATTTAGACATGAACAACTAAAGTGATATTCATGGAAATTTTGGTAAC
TAAGGAATGCAAAATATTGGGTAGGGCAATCTCTATGAATAGTATTACAAAAGTCCTTCA
CTCAGACCTAACGGTAGAAAGCTTAGTGAATTATTCACAATTCACGATTTTAAAGAACGT
AAAAATAGCTTCAACAGTGATTATGGAAATTTGACTATCTTTAAAGATTTGTTTTAGGAA
AACTCTTTCAATAGTCGTCGTCCTTCAATGAATATCCCCGAATCTAAAAATTATCGTAAA
GGATCAATTTTCCAACTTCAAAAGATGGAAGAAGACGGAATTATGGTTGATCTTGATATG
AATTAAGGAGATTTGAATAATATGATGACTGCTAATTAATCACAAGAAATTCACCACAAC
TTACAAAGTAATTATGATCAAATGAATAGCTAAAGCGCTAATAATAATGCAAATATCAAT
AGTAATGTAGGACTTGAAAGCAATTACGCTAATTAAAGCGATTAAATGATAGGAAACAAC
TCATAGCAATTTATTTAGAACTCGACAATTCTTTCTTAATTAAACAATAATAAGGCTGAA
TAATCAGAAGTCCAATTGAAGACATAACAGCGCATAAATCATCACCACCAAATGCAAAAT
AATAGATTGCAATAACCTATTTAAAAGTAAGGATACACAAGCAACAATCCCTAATTGCAT
CATCACATCTACCAACAAAGAGAAGTCTCTCCCTAAATGCAATTCAATCCTGATTCAGCT
AAGGTAGGATACGCTCACAGTCCCTACATCCCTTTAGTCGTTAGAAGCAAATCTCCTTCT
AACAAAATTAAAAAAGAAGAAAAATGCTACAAATGTAACTACGCAGACTGTGACAAATTT
TATACAAAGGTACTTTTTCTATTCCATTCATTTGATATTTTAATTAATTTTTGAATGATT
AAGTGAGTAATATATGCGATTTACATTTATTCATTCATTTGTGCGATTTACATTTATTCA
TTCATTTGTTTGCTCATCAAACTAATTTAAAAATTCTTTATTGATCTAAAAATATCTTTT
AATAAAATAGCTCTCAAATTTGAAAACTCACATCAGAACCTTCCACTTTAAGAGTAAAGA
CTTTAAATGCAATTATCAAGGTTGTAAATCAGCGTACCTCCACAAGAAGAGCTTAAAAGA
GCATATAGCCCGTGTGCATAAATCTGCTCCTGGCGCTTATATCCCAGGAAGCAAGAGAAA
TTCAGAAGATTATGAATACTCAGACGAACATTAAATGAATCAATTAAACTAGAACCAAAT
AAAGGAGATTTTACCAAAAATTTAATACGATGAGCATGATCACTAATAAATTTTATAGTA
ATCTCAATAGTAAATATCATAGCAATAACAGTACCATATTTCTCACCAAAGCCATCATCT
CCAAAATCACCACTAATAAAATTCCGTACAACAAAATGATCTCCTTGCAAACCATTCATC
CATGTATGGCCTGTACATTCCCTCCCCGAACTCTGCTTCCCAAAATACTACTTCCCAAAT
AAATTATCATTAGTAATTCACCCAGTAGCAATAACAATAGCAGTAATAATAATAATAGCA
GTAATTGCATCAGAACTCATTTTCATCTTCCATGCAAAATGCAGCAACAGCAGCAGTAGC
AGCTCCTTTTTACTCCTATTAAAATTAACCTGAATATGTTGTTTAGCATGATGCATAATT
GTAAATACCTCTTCTTTAATCAACTTAATCATAATAATAACAATATTAACCTAACTATCC
ATAACTTCATAGAAATCTCAGTCTCCCTACCCATCACTCTCAATAAACTAAATCGTCAGT
CTTTATGGCTTGA