Identifiers and Description

Gene Model Identifier

TTHERM_00462849

Standard Name

None

Aliases

3823.m01106

Description

Spt4/RpoE2 zinc finger protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00462849

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10756.13.00017180903994e-49hypothetical protein (123 aa)
OxytrichaContig18001.0.g600.0000000006000548789370351Spt4/RpoE2 zinc finger
DictyBaseDDB_G02852930.000000009996807949091551spt4 on chromosome: 4 position
3068070 to 3068424

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00462849(protein)
MADFDYDEEEQDFENYDEDVYNENIEVKKIIPPNDFKRKLLACTNCYFILTQEQWRDYQN
CPNCDVSSNNPKPTAKFTGITCITDPAKSWQTNRMRIVKRKDVKVPGAYAVNINEDYDYQ
QDTFE


>TTHERM_00462849(coding)
ATGGCAGATTTTGATTACGATGAAGAAGAACAAGATTTTGAAAACTACGATGAAGACGTT
TACAACGAAAACATCGAAGTGAAAAAAATAATTCCTCCAAACGATTTTAAAAGAAAACTG
TTGGCATGCACAAACTGCTATTTCATATTAACTCAAGAATAGTGGAGAGATTATCAAAAT
TGTCCTAACTGCGATGTATCTAGCAATAATCCTAAACCAACTGCAAAGTTTACAGGTATT
ACATGCATCACTGATCCAGCAAAAAGTTGGTAGACAAACAGAATGAGAATAGTCAAAAGA
AAAGATGTAAAAGTTCCTGGAGCTTATGCAGTCAATATAAACGAAGATTATGATTATTAA
TAAGACACCTTTGAATGA


>TTHERM_00462849(gene)
ATGGCAGATTTTGATTACGATGAAGAAGAACAAGATTTTGAAAACTACGATGAAGACGTT
TACAACGAAAACATCGAAGTGAAAAAAATAATTCCTCCAAACGATTTTAAAAGAAAACTG
TTGGCATGCACAAACTGCTATTTCATATTAACTCAAGAATAGGTAATAAATTAATTTTAA
AATGAAAAAGTTAAATAAAAATGACGAAATAAATAAAATGAAATAGTGGAGAGATTATCA
AAATTGTCCTAACTGCGATGTATCTAGCAATAATCCTAAACCAACTGCAAAGTTTACAGG
GTAATTTATTTTAATAGTTTTTAGAATATGAATATTAACTATATATATTGGAAATTTTTA
TAAGTATTACATGCATCACTGATCCAGCAAAAAGTTGGTAGACAAACAGAATGAGAATAG
TCAAAAGAAAAGGTAATAATTAGAATATTCTAAACAAAATACGTTCTATATTTATTTTTC
AATTAATTAATTAAAGATGTAAAAGTTCCTGGAGCTTATGCAGTCAATATAAACGAAGAT
TATGATTATTAATAAGACACCTTTGAATGA