Identifiers and Description

Gene Model Identifier

TTHERM_00459380

Standard Name

None

Aliases

PreTt20369 | 53.m00271 | 3712.m00129

Description

cactus-binding carboxy-terminal cactin protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03914 ) CBF/Mak21 family
  • ( PF03413 ) Peptidase propeptide and YPEB domain
  • ( PF06658 ) Protein of unknown function (DUF1168)
  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( PF07200 ) Modifier of rudimentary (Mod(r)) protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00459380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13828.19.997093137033517e-262hypothetical protein (676 aa)
DictyBaseDDB_G02793172.9994376937714457e-52DDB_G0279317 on chromosome: 3
position 1928580 to 1930763
WormBaseWBGene000122305.997992534675281e-52locus:cacn-1 Cactin status
:Confirmed UniProt:G5EG14
protein_id:CBY25191.1
OxytrichaContig20889.0.g227.002411919958887e-50Cactus-binding C-terminus of c
actin protein
Stentor CoeruleusSteCoe_347745.900090541597061e-29

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00459380(coding)
ATGGGAAGAAGAGATTATAAAAACAGATCTTCTTCGCGATCACCATCCAATTAAGAGGTA
GATGAGTAAAAAGATAAAAAGAGAAGATAAGATAGAGATAGATCGAGAAGAAGATCATCA
TCTTCATCTTCTAATTCTCAAAGAAGAAAGGGAGATAAATAAAAGTAAAATAAGTAGCAA
TCAAGATCCAGATCAAAGGAAAATAAAAGTAGAAATGATAAAAAGAACAAAAAGAAATAA
AATAAGAATTAATCAAGGTCTTCTTCTTCTTAATCTTCTTCTTCTTCATCATCTTCCTCA
TCAGGTAGCGACGAAGAGGCTGAAAAGAAATAAGCTGAAGAATATCTTAAAATGACTAAA
ATGAGATAGGAAATAATAGAAAGAGAATTACAATATAAAGGAGAGGAGAATCCTTTTGGT
GACAAAGATATTGCAGAAACATTAAATTGGGGTAAAAATGCCAATAATTAAAATAAATCT
ATTCATGAAATTATGGATGATATATAACGTGTTAAATAAATACGTTAGTAGCGTAAGGAA
GATGAAAAGCGTTTAGAAGAAATGAGAAATAAGGCAATACAGGAAAGAGAGGAAGAGTAA
TATTAGTAATGGAAAGAAAAAGAGGAAAAGTTTCATGCATACTAGGCTCGTATAAGAGCC
CTTGTGCGTATTACTCAAGGAAAAGAGACAACAGTAGATAAAATTAACAAAATTTTTTAT
ATCTATCGTCGAAAGATTAAATACAGTGAGCATTTAGATCCAATTATGAGCAATGTATAA
GCCTTTATAAAGAAATAAGATGAAGAAGAACTCGAAAAAATATTAGCTCAGGCAATTAAT
CATCACAATTAATTACAAGACCCCGTAGCTATCAATGACTAATAGTATAAAGATGAAAGC
GAAATAGTTAAATTTTCTTAGTTTTGGGAAAGTATAAGGTCTATCACTTAATATTATTTG
GATGAATTTCGTAAGAGAGATTAGTAAAAGGAAGTGTTACCTGAGTTTGAAGAGGAAATA
AAAGCTATTTTTGAAGGTAAAAATCTGGAAGAACTTCTTGAGCTAGAAAAAGGAATCAAC
CAAAGTATATAACTCACAAAGTATGGAAGCTAAGAAGATCAATAATATTGGCAAAATATG
CATAAAAGATTACAATTATATAAAGGAGATGCCATTCTAAAGAATTTTTATGATTATTTT
TCTACTCATTAGAATGAGTTTCAAGCAGAAGATGCTCTTGAAATAGAAGTGGAAAATAAA
CCACAGCTTACTGAGGAATAATTATTAGCTGAGTAAATATAAACCGAGTAGTTAGAAGCT
GAAGCTCATGTTTACTCTCCTATACTAATGCCTATCAGTGAAGAAACACTACGTTCTTCA
TAAACCTAATCAGAATTTACAGAGTAGGTTGTTTAACTTAGATAAGTCTATTATAACAAA
ATATTAAAACGAGCTTTAACAGCTTTAGAAAATAAGCGCGAAAAAGAATCTAAGCTAATA
GATACATTTGTTCCCGTAATTGGTGGTTTAACAACTGTGAAACAAGATAGAGAAGATGTA
GATGCTGCCACACTACATTTACTGGAAATGGAAAAGAAAAAACCAATGGAAGATGGAGAA
TAAGTATTTGATGATCAGCAAGCTATTGAAGATAAAGACTATAATTGGTCTGACAAATAC
AAATCAAAGAAGCCTAAGTATTATAATCGTGTTAAATTAGGATTCGATTGGAATAAATAT
AATAGAGCTCATTATGATTCTGATAATCCTCCTCCAAAGTACGTACAAGGTTATAAATTT
AATATTTTCTACCCAGAGCTGGTTGATATGTAAAAGACTCCAGAATATTTCTTAGAGCCT
ACAGATGAACAAGGATATTGTATTATCAGATTTACTGCTGGGCCACCTTATGAAGATGTA
GCTTTTAAAATCATCAATAAAGAATGGGATTATGCAGACAAAAAAGGATTTAAATGTTAT
TTCAATCGTGGTGTTTTAACTTTGCACTTTAATTTTAAAAGAAGTATTTCAAGACGTTGA


>TTHERM_00459380(protein)
MGRRDYKNRSSSRSPSNQEVDEQKDKKRRQDRDRSRRRSSSSSSNSQRRKGDKQKQNKQQ
SRSRSKENKSRNDKKNKKKQNKNQSRSSSSQSSSSSSSSSSGSDEEAEKKQAEEYLKMTK
MRQEIIERELQYKGEENPFGDKDIAETLNWGKNANNQNKSIHEIMDDIQRVKQIRQQRKE
DEKRLEEMRNKAIQEREEEQYQQWKEKEEKFHAYQARIRALVRITQGKETTVDKINKIFY
IYRRKIKYSEHLDPIMSNVQAFIKKQDEEELEKILAQAINHHNQLQDPVAINDQQYKDES
EIVKFSQFWESIRSITQYYLDEFRKRDQQKEVLPEFEEEIKAIFEGKNLEELLELEKGIN
QSIQLTKYGSQEDQQYWQNMHKRLQLYKGDAILKNFYDYFSTHQNEFQAEDALEIEVENK
PQLTEEQLLAEQIQTEQLEAEAHVYSPILMPISEETLRSSQTQSEFTEQVVQLRQVYYNK
ILKRALTALENKREKESKLIDTFVPVIGGLTTVKQDREDVDAATLHLLEMEKKKPMEDGE
QVFDDQQAIEDKDYNWSDKYKSKKPKYYNRVKLGFDWNKYNRAHYDSDNPPPKYVQGYKF
NIFYPELVDMQKTPEYFLEPTDEQGYCIIRFTAGPPYEDVAFKIINKEWDYADKKGFKCY
FNRGVLTLHFNFKRSISRR


>TTHERM_00459380(gene)
ATGGGAAGAAGAGATTATAAAAACAGATCTTCTTCGCGATCACCATCCAATTAAGAGGTA
GATGAGTAAAAAGATAAAAAGAGAAGATAAGATAGAGATAGATCGAGAAGAAGATCATCA
TCTTCATCTTCTAATTCTCAAAGAAGAAAGGGAGATAAATAAAAGTAAAATAAGTAGCAA
TCAAGATCCAGATCAAAGGAAAATAAAAGTAGAAATGATAAAAAGAACAAAAAGAAATAA
AATAAGAATTAATCAAGGTCTTCTTCTTCTTAATCTTCTTCTTCTTCATCATCTTCCTCA
TCAGGTAGCGACGAAGAGGCTGAAAAGAAATAAGCTGAAGAATATCTTAAAATGACTAAA
ATGAGATAGGAAATAATAGAAAGAGAATTACAATATAAAGGAGAGGAGAATCCTTTTGGT
GACAAAGATATTGCAGAAACATTAAATTGGGGTAAAAATGCCAATAATTAAAATAAATCT
ATTCATGAAATTATGGATGATATATAACGTGTTAAATAAATACGTTAGTAGCGTAAGGAA
GATGAAAAGCGTTTAGAAGAAATGAGAAATAAGGCAATACAGGAAAGAGAGGAAGAGTAA
TATTAGTAATGGAAAGAAAAAGAGGAAAAGTTTCATGCATACTAGGCTCGTATAAGAGCC
CTTGTGCGTATTACTCAAGGAAAAGAGACAACAGTAGATAAAATTAACAAAATTTTTTAT
ATCTATCGTCGAAAGATTAAATACAGTGAGCATTTAGATCCAATTATGAGCAATGTATAA
GCCTTTATAAAGAAATAAGATGAAGAAGAACTCGAAAAAATATTAGCTCAGGCAATTAAT
CATCACAATTAATTACAAGACCCCGTAGCTATCAATGACTAATAGTATAAAGATGAAAGC
GAAATAGTTAAATTTTCTTAGTTTTGGGAAAGTATAAGGTCTATCACTTAATATTATTTG
GATGAATTTCGTAAGAGAGATTAGTAAAAGGAAGTGTTACCTGAGTTTGAAGAGGAAATA
AAAGCTATTTTTGAAGGTAAAAATCTGGAAGAACTTCTTGAGCTAGAAAAAGGAATCAAC
CAAAGTATATAACTCACAAAGTATGGAAGCTAAGAAGATCAATAATATTGGCAAAATATG
CATAAAAGATTACAATTATATAAAGGAGATGCCATTCTAAAGAATTTTTATGATTATTTT
TCTACTCATTAGAATGAGTTTCAAGCAGAAGATGCTCTTGAAATAGAAGTGGAAAATAAA
CCACAGCTTACTGAGGAATAATTATTAGCTGAGTAAATATAAACCGAGTAGTTAGAAGCT
GAAGCTCATGTTTACTCTCCTATACTAATGCCTATCAGTGAAGAAACACTACGTTCTTCA
TAAACCTAATCAGAATTTACAGAGTAGGTTGTTTAACTTAGATAAGTCTATTATAACAAA
ATATTAAAACGAGCTTTAACAGCTTTAGAAAATAAGCGCGAAAAAGAATCTAAGCTAATA
GATACATTTGTTCCCGTAATTGGTGGTTTAACAACTGTGAAACAAGATAGAGAAGATGTA
GATGCTGCCACACTACATTTACTGGAAATGGAAAAGAAAAAACCAATGGAAGATGGAGAA
TAAGTATTTGATGATCAGCAAGCTATTGAAGATAAAGACTATAATTGGTCTGACAAATAC
AAATCAAAGAAGCCTAAGTATTATAATCGTGTTAAATTAGGATTCGATTGGAATAAATAT
AATAGAGCTCATTATGATTCTGATAATCCTCCTCCAAAGTACGTACAAGGTTATAAATTT
AATATTTTCTACCCAGAGCTGGTTGATATGTAAAAGACTCCAGAATATTTCTTAGAGCCT
ACAGATGAACAAGGATATTGTATTATCAGATTTACTGCTGGGCCACCTTATGAAGATGTA
GCTTTTAAAATCATCAATAAAGAATGGGATTATGCAGACAAAAAAGGATTTAAATGTTAT
TTCAATCGTGGTGTTTTAACTTTGCACTTTAATTTTAAAAGAAGTATTTCAAGACGTTGA