Identifiers and Description

Gene Model Identifier

TTHERM_00446570

Standard Name

None

Aliases

PreTt03924 | 51.m00290 | 3704.m00146

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00505 ) HMG (high mobility group) box
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00446570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10792.18.995665346759514e-138hypothetical protein (322 aa)
DictyBaseDDB_G02727400.000000000010004361180063202DDB_G0272740 on chromosome: 2
position 2228582 to 2229156
SGDYOR358W0.000000000040005666873964816HAP5 Subunit of the heme-activ
ated, glucose-repressed Hap2/3
/4/5 CCAAT-binding complex, a
transcriptional activator and
global regulator of respirator
y gene expression; required fo
r assembly and DNA binding act
ivity of the complex
OxytrichaContig15089.0.g940.000000009000371344152433Histone-like transcription fac
tor (CBF/NF-Y) and archaeal hi
stone
WormBaseWBGene000177420.0000020007268868677913locus:nfyc-1 status:Confirme
d UniProt:O17072 protein_i
d:CCD62352.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00446570(coding)
ATGGATTAAGAATAGTTGGAATTCGATTATGAAGATGAGTTTCAGGATCTAAACTTAGAG
TAGTAGCTAGCATAGCCTACAAGGTTTTTAAAAAGCTAAAATGGTGAAAAACAATAAATA
TAAACTAATACAGAAATGTAGAATAAAGAAGATATTACTAATTAAAAGAAGCATTTATAA
AAGCCTAAAAAGCCTTTGAGTGCATACTTTTTATTTATTTAAGACTATAAGCAAAAATGT
GGAAGCAAAATAAACTTGAAAGAAATGGGAAATATATGGAATGAAACTTCGTAAGATGAA
AAGCAAATATACTATAAAAAATAAGAAGAAGAAAAAGCTCGCTTTAAAAAAGAAATGGAC
GAATATATTGAATAGCAAGGTGACGAGGAAAATGAAGAACAATTAGATAATGAATTAGAT
ATTGCTTTTCCTATATCAAGGATTAAAGGTATTCTTAAAGTTGATGAAGACAATAAACTA
TTAAGCAAAGACACACTCCTTTACTTTGAAAAAGCTACAGAATTATTTGGGGGTTATTTA
GCTTAAAAATGTTTTAGAAATATGCAATAAAATCGCAGAAAAAAATTATAAACTGGTGAT
CTATATGAAGTAATTAAAAGGGACATGTACTTGAACTTCTTATAATGTATGGTGCCTTAA
GAAGCAACTGGTGAAGAAGAAAACCAATAAAATGTAATTAGTGGAAGCTAGCAGTCATCA
AAAACAAAATCTCGCAAAAGATTAGTCATTGCTGACGATGAAGATGTAAACTAAGAAGGC
AACATGGAAATAGAAAATAAAGATTTAGAGTAATAGGAGATTCCTGAATCAAGTAATAAA
AAAAATGTTAATACTAAGAGCAATAATAAACCAGGTAAAAAAGAAAAGGTTGTGCTACCT
CCTGCTAATAATAGCAGGATCGACAGCTTTTTTACTAAAAAGTGA


>TTHERM_00446570(protein)
MDQEQLEFDYEDEFQDLNLEQQLAQPTRFLKSQNGEKQQIQTNTEMQNKEDITNQKKHLQ
KPKKPLSAYFLFIQDYKQKCGSKINLKEMGNIWNETSQDEKQIYYKKQEEEKARFKKEMD
EYIEQQGDEENEEQLDNELDIAFPISRIKGILKVDEDNKLLSKDTLLYFEKATELFGGYL
AQKCFRNMQQNRRKKLQTGDLYEVIKRDMYLNFLQCMVPQEATGEEENQQNVISGSQQSS
KTKSRKRLVIADDEDVNQEGNMEIENKDLEQQEIPESSNKKNVNTKSNNKPGKKEKVVLP
PANNSRIDSFFTKK


>TTHERM_00446570(gene)
ATGGATTAAGAATAGGTTTGCATAAATTAAATTTATATAAAAAGATTGAGTGATTAAAGA
TTTCCCTTAAATATTAGTTGGAATTCGATTATGAAGATGAGTTTCAGGATCTAAACTTAG
AGTAGTAGCTAGCATAGCCTACAAGGTTTTTAAAAAGCTAAAATGGTGAAAAACAATAAA
TATAAACTAATACAGAAATGTAGAATAAAGAAGATATTACTAATTAAAAGAAGCATTTAT
AAAAGCCTAAAAAGCCTTTGAGTGCATACTTTTTATTTATTTAAGACTATAAGCAAAGTA
ATTGGTAATTTTCTCAAATGTTTCAGTTATTTATGTATGTGCATTATAAAATTAGAATGT
GGAAGCAAAATAAACTTGAAAGAAATGGGAAATATATGGAATGAAACTTCGTAAGATGAA
AAGCAAGTAAGAAAAATAATTTATTAAATTGAATTATGCATATGTAGTGATGAAAATCTT
AAAAATTAGATATACTATAAAAAATAAGAAGAAGAAAAAGCTCGCTTTAAAAAAGAAATG
GACGAATATGTAAAAATTAATAATTAAACTATTTTAATTTTAAATTTAAAATATTTTTAT
AAAAACATAGATTGAATAGCAAGGTGACGAGGAGTAAAAAATATTTTTAATTAAAAATTG
AGTTTAAATTATTATTTTTGTTAGAAATGAAGAACAATTAGATAATGAATTAGATATTGC
TTTTCCTATATCAAGGATTAAAGGTATTCTTAAAGTTGATGAAGACAATAAACTATTAAG
CAAAGACACACTCCTTTACTTTGAAAAAGCTACAGTAAAATTTCAATGGATTTTTTTATA
GTTTTAATTTTTTGGTTAATTTAAAGGAATTATTTGGGGGTTATTTAGCTTAAAAATGTT
TTAGAAATATGCAATAAAATCGCAGAAAAAAATTATAAACTGGTGATCTATGTAAAATAA
AATAATAAAAATATCTAAAAAATTTAATAAGATTTTAAAAAAATAAGATGAAGTAATTAA
AAGGGACATGTACTTGAACTTCTTATAATGTAATTTATTATTTAGTTGAAAATATTAATA
ATACTTCTAAAAAGGTATGGTGCCTTAAGAAGCAACTGGTGAAGAAGAAAACCAATAAAA
TGTAATTAGTGGAAGCTAGCAGTCATCAAAAACAAAATCTCGCAAAAGATTAGTCATTGC
TGACGATGAAGATGTAAACTAAGAAGGCAACATGGAAATAGAAAATAAAGATTTAGAGTA
ATAGGAGATTCCTGAATCAAGTAATAAAAAAAATGTTAATACTAAGAGCAATAATAAACC
AGGTAAAAAAGAAAAGGTTGTGCTACCTCCTGCTAATAATAGCAGGATCGACAGCTTTTT
TACTAAAAAGTGA