Identifiers and Description

Gene Model Identifier

TTHERM_00446320

Standard Name

None

Aliases

PreTt03899 | 51.m00265 | 3704.m00121

Description

pre-rRNA-processing protein TSR2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.9%

TetraMine Data

TTHERM_00446320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10820.11.0001689416974253e-96hypothetical protein (217 aa)
OxytrichaContig9973.0.g730.00000008001913847069386Pre-rRNA-processing protein TS
R2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00446320(coding)
ATGGATTCAAAAAATTAATACGAAGAAGTTGATAGAAGATTTAAGGAAGGCTTGACTATT
ATAGTCTTGAATTGGCCTGTTATTAAATTGATAGTATAGAATGGATGGGTTGGTTAAAAT
GAAGAAAGAATTAGAGATGACCCTGAAGCTAAGTAATTAAATTTGGACTCTGAATTCAAA
TCTGAGTCTTAAGTTGTTCAAGATTTTATTGAGGATTTATTCTAATACATAATAAAATAT
GATTGTAAGCCTGAAGATTTAGAAGATTGGTTACTTAAGGAAATCGAATACAGATTTTAT
ACATTAATTGAAGATAATTCTGAAAAAGAAATGACAAAAGCTATTCTCTCCTTATTTAAT
GAATTGGAAGATGGAAAATACACATTATATGAAGAGGTTAAAAAAATGGGAGCTTTGATG
AAGAATGTTAAAGTAAATGGTTAATGTGGCAACAAGGATGATGATGACAGTGATGAAGAA
GGAGAAGATTGGGAAGATTCAAGTGTTATTGGACCAAATGATAAAGTAGAAGAAGAGCTC
ACTGAAGAGGAATTATAAAAAATTGCTGAAGAAAAGGCAGAAGAAGAAAAAAAGAAACAA
ATTATGGAAGAAGATGGATTCTCAGTTGTAAGCAGCAAAAAGAAAAAGTGA


>TTHERM_00446320(protein)
MDSKNQYEEVDRRFKEGLTIIVLNWPVIKLIVQNGWVGQNEERIRDDPEAKQLNLDSEFK
SESQVVQDFIEDLFQYIIKYDCKPEDLEDWLLKEIEYRFYTLIEDNSEKEMTKAILSLFN
ELEDGKYTLYEEVKKMGALMKNVKVNGQCGNKDDDDSDEEGEDWEDSSVIGPNDKVEEEL
TEEELQKIAEEKAEEEKKKQIMEEDGFSVVSSKKKK


>TTHERM_00446320(gene)
ATGGATTCAAAAAATTAATACGAAGAAGTTGATAGAAGATTTAAGGAAGGCTTGACTATT
ATAGTCTTGAATTGGCCTGTTATTAAATTGATAGTATAGAATGGATGGGTTGGTTAAAAT
GAAGAAAGAATTAGAGATGACCCTGAAGCTAAGTAATTAAATTTGGACTCTGAATTCAAA
TCTGAGTCTTAAGTTGTTCAAGATTTTATTGAGGATTTATTCTAATACATAATAAGTAAT
TAAATTTAACATAATTAGTTTAAAAATAATAAAAATTTCTTTATTTAGAATATGATTGTA
AGCCTGAAGATTTAGAAGATTGGTTACTTAAGGAAATCGAATACAGATTTTATACATTAA
TTGAAGATAATTCTGAAAAAGAAGTAATTGGATTTAAATAAAAATGTATATATATTTTTT
ACAATAACAAATTTTAAAGATGACAAAAGCTATTCTCTCCTTATTTAATGAATTGGAAGA
TGGAAAATACACATTATATGAAGAGGTTAAAAAAATGGGAGCTTTGATGAAGAATGTTAA
AGTAAATGGTTAATGTGGCAACAAGGATGATGATGACAGTGATGAAGAAGGAGAAGATTG
GGAAGATTCAAGTGTTATTGGACCAAATGATAAAGTAGAAGAAGAGCTCACTGAAGAGGA
ATTATAAAAAATTGCTGAAGAAAAGGCAGAAGAAGAAAAAAAGAAACAAATTATGGAAGA
AGATGGATTCTCAGTTGTAAGCAGCAAAAAGAAAAAGTGA