Identifiers and Description

Gene Model Identifier

TTHERM_00444520

Standard Name

None

Aliases

PreTt03820 | 51.m00186 | 3704.m00042

Description

cation channel family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08016 ) Polycystin cation channel
  • ( PF00520 ) transporter, cation channel family
  • ( PF00902 ) Sec-independent protein translocase protein (TatC)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00444520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10905.19.997093137033517e-262cation channel family protein
(964 aa)
OxytrichaContig15165.0.1.g630.0000000000000299873730555305Polycystin cation channel
Stentor CoeruleusSteCoe_147770.0000000001026187963170189
WormBaseWBGene000040350.0000000020002373268528243locus:pkd-2 Polycystin-2 s
tatus:Partially_confirmed Un
iProt:Q9U1S7 protein_id:CAB6
0565.3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444520(coding)
ATGAAGCACACAGAGAGTATTCAGAATATCATTAAAGAAGTTGAAAAAAAGAAGGATGAA
ATAGCTTCTAAAAAAACAGAAATACTGACATTGCAACACCAGAATGTTGTTTTATCAGAA
CAAGCTTACATCCAAAAGGATAAACTTTATATGCTAGAAGCAGAGTATCAAGATAGAAAA
AGAATTTTTGAAAACCTCTATATCAAATACAAAAAGAAAAACTAGAATATGTAAGACGAA
GAATTTGAAGAGGCAGATATTGACGAGAGTATAAATCCTTTGAAAAAAATAGGAAAAAGA
GCCAATAGATTACATACTGAGATGAACTAAGATGATGAAAAAGAAAAGAAAAATCAATAA
GAAATATCAGATTTAAGAGTTTTAGAAGGAATATAAAACTACCTTGATAAATAAATACAA
AAATATGATAAAAACAGAATGATGAAGCAACTGAACTTCAGTCCATAAAAAGAGAAAAAT
AAAAATTAAAGCAAAAAGAACAATAATTATAGTGATAGCAGTAGTGAAGATGACAATAAT
GATTCAGACTCTGATAAATCCTAAGAAGATGCTCTTTTGCCAAAGGAAAAAAATAACGCA
CAATTTGTAAGACCCTTTAATCCTTTTACATGTGTGTTAATTAGATTCAAAACCAACAAA
GTAGCTGAAGTGGATGATGGGTCAAAGCTCTTACTGAGTATAAGAGTTGAAGAAAAAACA
AAATTTATTGAGATCAAAAGGGCTGCTTGCCAATATTGGCAAGTAAAAGATCCTAACTAA
AAAGACATAAATGGAATACTTTCTTAAGCTATTCAAAAAGATGAAAACTTTTCTTTCATG
GATCTTTGCGATGAGACGAACTCATCACTACCTGACTCTGAGTTAGTCATTCAATTTTTA
ATGCAAAAAGGATATAAAAATTTAGGTTAATGTACATTAATTCTAAAACCCAAAGAATTT
AGAACGGGTCTTGATTCTCTTTAAGCAGAAAGCACTAGAATAAATAAAGGTGTTGATCAA
GAAAAATCATAAGGCCAATACTTTGTTAAAAAAGTTTAAAATAATTCAATAAACCCATAT
GATTTCTTTTTCTAAGAATATCCTTCTTTGCAGTTTTATATTGAATTGAAACAACTACAT
GAATCAGAATCTGGAGATTCGTAATAAGAAGAAATGGTATTAACAAAAAATGTGAATGAT
TCGCATTGCTGCATTCTAACTTTTTTGATTATGATAATTGTAGTTACAGCAATCTATTTA
TCAAAAATGATAGATGTAGAAATTAAACATTTCACAAATACTTATATTACAAACACTCTT
AAATTAGATAAATTAAATGATTTGTAAAACGATGCTATTTTTGATAACTTCTTAAAACTA
ACATTAAGTTAATGCTTTTTTGATTCTAGATATTACGCTCCAAATTAAGCCTACTTTAAA
GATAATTTCGCAACTATTGGTAATATTAGAATAAGATTCTAAATGTAAAATCTAACTTAA
TGTGATATATACGCGAATAGTTAATCAAAAAACGTTTGTTTTAACTTAGATGAAACTCAA
CTTTTAAAGAAGGATATAGGTTCCAGCTCATCAAAATATTAATTTTAAAAGTTTTAAAAT
GGACCTACAGATAAAAACTAACGCTTTGACTTGAAAGGTACTTATGGAACATACTCTCCT
GAAGGCTATATGTTAGATTTTAACGTGACAATATCAAGAAAAAATTATCAAGGCCAGATA
GATTTACTAAAAAATCTCATCTTATATGAACTAGAACTAAGAGTTATTATAGTAACATTT
ACTCTCTACAATCCAACATTAGATATATGGGTAAACGTAAATATTATAATTGAAAGAGAT
CGCTATGGTTCAATGATACCTTCCACTCCTAAAATCTACTTTTTTAAACCAAACATATAT
GAAGGACCTGATGGTTCTACTATGTTAGCATTAGATATCATCAGACTTGTTTCTACAGTT
ATTTTGCTTATATTTGTTTTTTACTAAATCTATTTAACACAGTTGAGCTATGTTTTTAGT
TTGTTAGGATTTCTTAATATAACTGTTATTGGTTTTAGTGTAGCATCTCTAGCTCTTAGT
TTTCTATCTTACTCTTGTGGATTTGATGAAAATAAATTATTTAGTTTACATACCAATATG
GTGAAAGAATATGATAGTCTTGATATAAAAAATATTACATTAGACAACTGGATAGCATTT
TAAAATAAATATTATGTAGATTTGACTTATGTAGGATATCTTTACACTTCCTTACAGAGC
ATACAATCAATCTTGATAACAATCCTCCTATTTAGATTCATTTTTGTTTTTTCATTCTCC
ATTTATCTTAAAACAATTGTGGATACAATTAAAAATGCTGGAGGAGATTTGCTTAAGTAT
TTCATCATACTTTTGCCACTTTTAATTTCTTTCGCACTTATTTTTTATTAAATCTGGGGA
GCTTACATAGAATAATTTAATAACTTGACTGCTTCTTTATGCTCTGTTATTCTAATGACT
ATTGGATATATGAATGCTGATTAAATCAATTAAATTAATACCGTATGGTCAATTATTTTT
GTAGTTCTTTTTTACCTCCTGATTATTTTCCTTTTCTACAGCTTTATTTTGGGAATTATG
GTTGAGAGTTAGCATAGTGTAATTATGTAAAAAGGTTATCCTTCAATGCAGAAATCTACA
ATTACAGGTGTAATTATAATATAATGGTTATTTTAGTGGGTTCCTGAAGTGGTAAAGGAT
TACTTTAGTAAATTTGTTAGCATTATAAACGATGCATCAAGTAGTAATGAAAAAAAAGTT
GATGGTGAATAAAATAGTTTTGATGAAACTTAAAACTTAAAAAGTGGTAAAATGTGA


>TTHERM_00444520(protein)
MKHTESIQNIIKEVEKKKDEIASKKTEILTLQHQNVVLSEQAYIQKDKLYMLEAEYQDRK
RIFENLYIKYKKKNQNMQDEEFEEADIDESINPLKKIGKRANRLHTEMNQDDEKEKKNQQ
EISDLRVLEGIQNYLDKQIQKYDKNRMMKQLNFSPQKEKNKNQSKKNNNYSDSSSEDDNN
DSDSDKSQEDALLPKEKNNAQFVRPFNPFTCVLIRFKTNKVAEVDDGSKLLLSIRVEEKT
KFIEIKRAACQYWQVKDPNQKDINGILSQAIQKDENFSFMDLCDETNSSLPDSELVIQFL
MQKGYKNLGQCTLILKPKEFRTGLDSLQAESTRINKGVDQEKSQGQYFVKKVQNNSINPY
DFFFQEYPSLQFYIELKQLHESESGDSQQEEMVLTKNVNDSHCCILTFLIMIIVVTAIYL
SKMIDVEIKHFTNTYITNTLKLDKLNDLQNDAIFDNFLKLTLSQCFFDSRYYAPNQAYFK
DNFATIGNIRIRFQMQNLTQCDIYANSQSKNVCFNLDETQLLKKDIGSSSSKYQFQKFQN
GPTDKNQRFDLKGTYGTYSPEGYMLDFNVTISRKNYQGQIDLLKNLILYELELRVIIVTF
TLYNPTLDIWVNVNIIIERDRYGSMIPSTPKIYFFKPNIYEGPDGSTMLALDIIRLVSTV
ILLIFVFYQIYLTQLSYVFSLLGFLNITVIGFSVASLALSFLSYSCGFDENKLFSLHTNM
VKEYDSLDIKNITLDNWIAFQNKYYVDLTYVGYLYTSLQSIQSILITILLFRFIFVFSFS
IYLKTIVDTIKNAGGDLLKYFIILLPLLISFALIFYQIWGAYIEQFNNLTASLCSVILMT
IGYMNADQINQINTVWSIIFVVLFYLLIIFLFYSFILGIMVESQHSVIMQKGYPSMQKST
ITGVIIIQWLFQWVPEVVKDYFSKFVSIINDASSSNEKKVDGEQNSFDETQNLKSGKM


>TTHERM_00444520(gene)
ATGAAGCACACAGAGAGTATTCAGAATATCATTAAAGAAGTTGAAAAAAAGAAGGATGAA
ATAGCTTCTAAAAAAACAGAAATACTGACATTGCAACACCAGAATGTTGTTTTATCAGAA
CAAGCTTACATCCAAAAGGCATGATTTATTTATTATTTGATGTTTTTAGATAGTTTAATT
TCTAATTTTATTAACAAATACGATTGCAAATCTTAAATAAATTGTTGGCTATTTTAAAAC
TAAATCAACTTAAAAAAGGATAAACTTTATATGCTAGAAGCAGAGTATCAAGATAGAAAA
AGAATTTTTGAAAACCTCTATATCAAATACAAAAAGAAAAACTAGAATATGGTAATCTCC
ATTTTTACAATTTAGATAGTTGTTTTTGGTTTGATTAAATTAAAAACTTATATTTATAAA
GTAAGACGAAGAATTTGAAGAGGCAGATATTGACGAGAGTATAAATCCTTTGAAAAAAAT
AGGAAAAAGAGCCAATAGATTACATACTGAGATGAACTAAGATGATGAAAAAGAAAAGAA
AAATCAATAAGAAATATCAGATTTAAGAGTTTTAGAAGGAATATAAAACTACCTTGATAA
ATAAATACAAAAATATGATAAAAACAGAATGATGAAGCAACTGTAATTATTCAAGACTAA
TTTTTTTTAATGAAATGTTAAAATGTATTTTTTAAAATAAAAATTATAATAGGAACTTCA
GTCCATAAAAAGAGAAAAATAAAAATTAAAGCAAAAAGAACAATAATTATAGTGATAGCA
GTAGTGAAGATGACAATAATGATTCAGACTCTGATAAATCCTAAGAAGATGCTCTTTTGC
CAAAGGAAAAAAATAACGCACAATTTGTAAGACCCTTTAATCCTTTTACATGTGTGTTAA
TTAGATTCAAAACCAACAAAGTAGCTGAAGTGGATGATGGGTCAAAGCTCTTACTGAGTA
TAAGAGTTGAAGAAAAAACAAAATTTATTGAGATCAAAAGGGCTGCTTGCCAATATTGGG
TATTTAAAATTATTTGTTAAAATATGTTGTTTAGTTAATCTAATAAAAATAATTTCTTTA
AAATAGCAAGTAAAAGATCCTAACTAAAAAGACATAAATGGAATACTTTCTTAAGCTATT
CAAAAAGATGAAAACTTTTCTTTCATGGATCTTTGCGATGAGACGAACTCATCACTACCT
GACTCTGAGTTAGTCATTCAATTTTTAATGCAAAAAGGATATAAAAATTTAGGTTAATGT
ACATTAATTCTAAAACCCAAAGAATTTAGAACGGGTCTTGATTCTCTTTAAGCAGAAAGC
ACTAGAATAAATAAAGGTGTTGATCAAGAAAAATCATAAGGCCAATACTTTGTTAAAAAA
GTTTAAAATAATTCAATAAACCCATATGATTTCTTTTTCTAAGAATATCCTTCTTTGCAG
TTTTATATTGAATTGAAACAACTACATGAATCAGAATCTGGAGATTCGTAATAAGAAGAA
ATGGTATTAACAAAAAATGTGAATGATTCGCATTGCTGCATTCTAACTTTTTTGATTATG
ATAATTGTAAATAAATAATTATGTTTGACATTTTTTGAAAGTTTTATAATATGATTTTTA
ATTAATTATTTAAAGGTAGTTACAGCAATCTATTTATCAAAAATGATAGATGTAGAAATT
AAACATTTCACAAATACTTATATTACAAACACTCTTAAATTAGATAAATTAAATGATTTG
TAAAACGATGCTATTTTTGATAACTTCTTAAAACTAACATTAAGTTAATGCTTTTTTGAT
TCTAGATATTACGCTCCAAATTAAGCCTACTTTAAAGATAATTTCGCAACTATTGGTAAT
ATTAGAATAAGATTCTAAATGTAAAATCTAACTTAATGTGATATATACGCGAATAGTTAA
TCAAAAAACGTTTGTTTTAACTTAGATGAAACTCAACTTTTAAAGAAGGATATAGGTTCC
AGCTCATCAAAATATTGTAACTTCATTTAACCAAAATAGTTAGTTATTCCAAATGTAATC
AATCACATTTTATAGAATTTTAAAAGTTTTAAAATGGACCTACAGATAAAAACTAACGCT
TTGACTTGAAAGGTACTTATGGAACATACTCTCCTGAAGGCTATATGTTAGATTTTAACG
TGACAATATCAAGAAAAAATTATCAAGGCCAGATAGATTTACTAAAAAATCTCATCTTAT
ATGAACTAGAACTAAGAGTTATTATAGTAACATTTACTCTCTACAATCCAACATTAGATA
TATGGGTAAACGTAAATATTATAATTGAAAGAGATCGCTATGGTTCAATGATACCTTCCA
CTCCTAAAATCTACTTTTTTAAACCAAACATGTAAGCATTTATATTTAAAAAATAAAAAC
AATACTCAAATATAAATTTATTTATTTAATTTTAGATATGAAGGACCTGATGGTTCTACT
ATGTTAGCATTAGATATCATCAGACTTGTTTCTACAGTTATTTTGCTTATATTTGTTTTT
TACTAAATCTATTTAACACAGTTGAGCTATGTTTTTAGTTTGTTAGGATTTCTTAATATA
ACTGTTATTGGTTTTAGTGTAGCATCTCTAGCTCTTAGTTTTCTATCTTACTCTTGTGGA
TTTGATGAAAATAAATTATTTAGTTTACATACCAATATGGTGAAAGAATATGATAGTCTT
GATATAAAAAATATTACATTAGACAACTGGATAGCATTTTAAAATAAATATTATGTAGAT
TTGACTTATGTAGGATATCTTTACACTTCCTTACAGAGCATACAATCAATCTTGATAACA
ATCCTCCTATTTAGATTCATTTTTGTTTTTTCATTCTCCATTTATCTTAAAACAATTGTG
GATACAATTAAAAATGTATAAACATTATTTATTTATTTATTTATTTATTTTTAGTTTTTT
GTAAGTTATTTTATGAATTAAATAAATAGGCTGGAGGAGATTTGCTTAAGTATTTCATCA
TACTTTTGCCACTTTTAATTTCTTTCGCACTTATTTTTTATTAAATCTGGGGAGCTTACA
TAGAATAATTTAATAACTTGACTGCTTCTTTATGCTCTGTTATTCTAATGACTATTGGAT
ATATGAATGCTGATTAAATCAATTAAATTAATACCGTATGGTCAATTATTTTTGTAGTTC
TTTTTTACCTCCTGATTATTTTCCTTTTCTACAGCTTTATTTTGGGAATTATGGTTGAGA
GTTAGCATAGTGTAATTATGTAAAAAGGTTATCCTTCAATGCAGAAATCTACAATTACAG
GTGTAATTATAATATAATGGTTATTTTAGTGGGTTCCTGAAGTGGTAAAGGATTACTTTA
GTAAATTTGTTAGCATTATAAACGATGCATCAAGTAGTAATGAAAAAAAAGTTGATGGTG
AATAAAATAGTTTTGATGAAACTTAAAACTTAAAAAGTGGTAAAATGTGA