Identifiers and Description

Gene Model Identifier

TTHERM_00444330

Standard Name

None

Aliases

PreTt03801 | 51.m00167 | 3704.m00022

Description

ribosomal protein S16 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00444330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10924.19.997093137033517e-262ribosomal protein S16 containi
ng protein (435 aa)
OxytrichaContig1412.1.g877.998167219297731e-26Ribosomal protein S16
SGDYPL013C0.00000005999527666938375MRPS16 Mitochondrial ribosomal
protein of the small subunit

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444330(coding)
ATGAGAGTTGTTATTAGACTTTAGCAATCTGGTTTTAAAAATCATCCAAGATGGAAAATT
GTTGTCATGCCCTAAAAGAAGAATCCCAGAGGTAGATTCCTTGAGCATGTTGGCTGGTGG
TGCCCAAGACAAGGAAAAATTAATTAAAGAGAGATTGTAGTTAATAAGGAACGTGTCAGA
TATTGGATTGCTATGGGAGCAAAGCCCTCTGAAAAAGTATAAAAATTCCTTTCTTATTTC
GACTTAGCTCCAAAGCCTTTGATTAAATATGGTTTTAAAACTCTTTATGAAAAACCAGAA
GTAACCCCTAAAGATTACTTGAATTTAAGTCCATATAAAATCAAGAATTTCGACAATCAT
CTCCATGAATTCATTTAATAAGAAGAAGAAGTCAAATTCCTCAAGTAATAAAGAATGAAA
AATGAACTCATTAAGTAAATAGCTGATAGTGATTTGAAGGATTCTCTTGATCCTAAACTT
ATTTAATAAGAATTATAGAGCCTCTAAACTGAGTTATAATAAATGAATTCTTAAATTAAC
TAAGTTGATTAAAAGAGAAGACAATTTGTCATTAAGAGAATAAATATCCTTTTCTCCTAA
TTAACCAAAGCTGAATAACACGAATCTTTCAAGCAAAAGATTTTACAAGGCAAAGAAGAT
TTAAAAGAAAAAATTGGTTCTGATAAGTTCTTAAGAAGAAGTCTTGAAGAAGCTAGCTTT
AATTAAACAATCGAAGCTTCTTATAAGAATTTTGAAGATTAGATCGAAGCTTTAAAGCCC
ATCACTAAAGAAGAATTTAAGGATTACTTATTATCTAAAGGTTTCCATGAAGCTAAGGCT
GATAAGACTGTCAGAAGATATTTCACTGAATAAGTCGTTGTTTTGAAAATACATGCTATT
GAAGCTACTACTGAAGTACCTGAAGTCGAACACGAGAATCAATTACATTTAGAGCACTTC
AGAAAAAATGACTAAGTTATCTTCCCTCTTCCTAACTCAATTACTCCTAGACCTGATATT
AACAGTTATGATGCTGCTGATTATTATGAAATACCTTAGATTTACGATCCTGCTACTCAA
GCTAACAAAGCCTACAATCTTACTAGCGTAACAGACAAATTAAACCCTGTTAAAAGAGAA
TATGCACACTTTATGTTCAAAAACGTCATGGGTCGCAAGAAACCTACAAGAGTTAGAACT
TAAAATCCTCCCGCCTTTTTTAAGAAGGGTTATAATAATTTTTCTACCATCAATAAACCT
TACTATATGTCAACTTTTGATTACTTGAGATACACAGGACTTTTTAAAAATTGA


>TTHERM_00444330(protein)
MRVVIRLQQSGFKNHPRWKIVVMPQKKNPRGRFLEHVGWWCPRQGKINQREIVVNKERVR
YWIAMGAKPSEKVQKFLSYFDLAPKPLIKYGFKTLYEKPEVTPKDYLNLSPYKIKNFDNH
LHEFIQQEEEVKFLKQQRMKNELIKQIADSDLKDSLDPKLIQQELQSLQTELQQMNSQIN
QVDQKRRQFVIKRINILFSQLTKAEQHESFKQKILQGKEDLKEKIGSDKFLRRSLEEASF
NQTIEASYKNFEDQIEALKPITKEEFKDYLLSKGFHEAKADKTVRRYFTEQVVVLKIHAI
EATTEVPEVEHENQLHLEHFRKNDQVIFPLPNSITPRPDINSYDAADYYEIPQIYDPATQ
ANKAYNLTSVTDKLNPVKREYAHFMFKNVMGRKKPTRVRTQNPPAFFKKGYNNFSTINKP
YYMSTFDYLRYTGLFKN


>TTHERM_00444330(gene)
ATGAGAGTTGTTATTAGACTTTAGCAATCTGGTTTTAAAAATCATCCAAGATGGTAATAA
TATATAAAATATTTTAAAATAAACAAAGAATAACAAGCAGAATTTAAATTAAAAAAGAGC
GCTCATTTTAAATTTGACAAGATAGAGTGAAATGAGTTAGATTTGAATTTAGAATTTTGA
GTTTTCAGTTTACTCGCCATACATATTTAATATTCAAAGTTTCTTTGATTATTTTTCACA
TTGTTAGAAATAAAAGGAAAATTATATCTACAAATAAATAGAACTCAATCATCTAAATTA
CAATGAATTATTATATATAGGAAAATTGTTGTCATGCCCTAAAAGAAGAATCCCAGAGGT
AGATTCCTTGAGCATGTTGGCTGGTGGTGCCCAAGACAAGGAAAAATTAATTAAAGAGAG
ATTGTAGTTAATAAGGAACGTGTCAGATATTGGATTGCTGTAAAGATTAGATTTACATTT
ATTTATTTCTCCTTAATGGGAATTCATAGAATATTCTACTCAAGTGCTTGTTTTTTAATT
CTTATTTATAAATTTAAATTAGATGGGAGCAAAGCCCTCTGAAAAAGTATAAAAATTCCT
TTCTTATTTCGACTTAGCTCCAAAGCCTTTGATTAAATATGGTATGTTCTTTTCCTCTTG
CTTTAAAATGCTGATTGATTGATTAATAATTAGATTTTTGAAAATTTAAGTACTCATAAA
AGCAAAATGAAATTTAAAAGTTTGTTTATTAAAAAAAAGGTTTTAAAACTCTTTATGAAA
AACCAGAAGTAACCCCTAAAGATTACTTGAATTTAAGTCCATATAAAATCAAGAATTTCG
ACAATCATCTCCATGAAGTAAATAATTGATAAAATGATTATATAGAAGTATCTTTTGATT
GAAAGGATATATATACAAATTCAACTAAAATATTAAGAAACTAAGTGATTAATTAATTTA
GTTTTATACTGCAAATCATGATAATTTAATTAAATTTTTATTTATGATAAAAAATTAGTT
CTTATTTTCTTAATATAGTTTGAATTTGCAATAAAATTTTGGTCATTTACACCTTTTTAT
TCTATGTATTTTTAATATAAAAATACATTTTATGGCCATACAATTCTAAATATTATTCAT
AAAAGCAATTTGTAAAACTTTTTTTAAAAATCAAAGTTCATTTAATAAGAAGAAGAAGTC
AAATTCCTCAAGTAATAAAGAATGAAAAATGAACTCATTAAGTAAATAGCTGATAGTGAT
TTGAAGGATTCTCTTGATCCTAAACTTATTTAATAAGAATTATAGAGCCTCTAAACTGAG
TTATAATAAATGAATTCTTAAATTAACTAAGTTGATTAAAAGAGAAGACAATTTGTCATT
AAGAGAATAAATATCCTTTTCTCCTAATTAACCAAAGCTGAATAACACGAATCTTTCAAG
CAAAAGATTTTACAAGGCAAAGAAGATTTAAAAGAAAAAATTGGTTCTGATAAGTTCTTA
AGAAGAAGTCTTGAAGAAGCTAGCTTTAATTAAACAATCGAAGCTTCTTATAAGAATTTT
GAAGATTAGATCGAAGGTAACTAACCAAAATAATTTCATGTTTCATTTAAATAATACCAT
TTTTAATATAATTCAAAAGCTTTAAAGCCCATCACTAAAGAAGAATTTAAGGATTACTTA
TTATCTAAAGGTTTCCATGAAGCTAAGGCTGATAAGGTTTTATTAATTAGCTTTATAAAT
TTAAATTAAAGTTGTATTTATACTCTAAATAGACTGTCAGAAGATATTTCACTGAATAAG
TCGTTGTTTTGAAAATACATGCTATTGAAGCTACTACTGAAGTACCTGAAGTCGAACACG
AGAATCAATTACATTTAGAGCACTTCAGAAAAAATGAGTAACAATCTATTTACACCCTTA
AAATAGTTCTTTTAATTTTGATATTTAAATAATAAACAGCTAAGTTATCTTCCCTCTTCC
TAACTCAATTACTCCTAGACCTGATATTAACAGTTATGATGCTGCTGATTATTATGAAAT
ACCTTAGATTTACGATCCTGCTACTCAAGCTAACAAAGGTTACAAATTAAAAATTATTAG
TTACTATTGATAACCATATTTTTATTATTTATTATTTTATTAGCCTACAATCTTACTAGC
GTAACAGACAAATTAAACCCTGTTAAAAGAGAATATGCACACTTTATGTTCAAAAACGTC
ATGGGTCGCAAGAAACCTACAAGAGTTAGAACTTAAAATCCTCCCGCCTTTTTTAAGAAG
GGTTATAATAATTTTTCTACCATCAATAAACCTTACTATATGTCAACTTTTGATTACTTG
AGATACACAGGACTTTTTAAAAATTGA