Identifiers and Description

Gene Model Identifier

TTHERM_00441970

Standard Name

None

Aliases

PreTt05597 | 50.m00166 | 3681.m00025

Description

tetratricopeptide repeat protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08238 ) Sel1 repeat
  • ( PF00904 ) Involucrin repeat
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( TIGR02795 ) tol-pal system protein YbgF
  • ( TIGR01784 ) conserved hypothetical protein
  • ( PF03508 ) Gap junction alpha-1 protein (Cx43)
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR00088 ) tRNA (guanine-N1)-methyltransferase
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( TIGR03302 ) outer membrane assembly lipoprotein YfiO
  • ( PF01239 ) Protein prenyltransferase alpha subunit repeat
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( TIGR00990 ) mitochondrial precursor proteins import receptor
  • ( TIGR02917 ) putative PEP-CTERM system TPR-repeat lipoprotein
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00441970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12536.19.997093137033517e-262hypothetical protein (2884 aa)
OxytrichaContig19078.0.g264.9994004612166366e-86TPR repeat
Stentor CoeruleusSteCoe_12323.975449735908647e-31
WormBaseWBGene000038584.999617891954556e-16locus:ogt-1 UDP-N-acetylgluc
osamine--peptide N-acetylgluco
saminyltransferase status:Co
nfirmed UniProt:O18158 pro
tein_id:CCD61614.1
SGDYBR112C0.0000000000000030004923591262316CYC8 General transcriptional c
o-repressor, acts together wit
h Tup1p; also acts as part of
a transcriptional co-activator
complex that recruits the SWI
/SNF and SAGA complexes to pro
moters; can form the prion [OC
T+]

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00441970(coding)
ATGTCAGATTATGATTATGAATAGGATTTTAGCGATTTGAATGATGAAAAACCTTAATCG
TAGGAAATCGAAAGGCATGAAGATTCTTAATTTCAATAAAATTAAGCAGTTTCACCTAGA
GAAGGACAAAACTCTTAAAATAATGGAGAATTAGAAAAGGATTCTGATTTTGGAGCGAAT
CATTCATACGTGTCATTTTCTCATGAAGAAAAGGAAATTGTTGAAAAATAAATTCATTAA
AATAGTAAACAGAGTAAACTATTTACAGATACTTCAGAAGAATTCAATAAAATTAGATCA
AACATAATAGAAAAGCAATTCTAATAAGCACTTGTCCAAATTGAAGAGTATTTAAGATTA
AATCCAAAAAGTGTTGAAGCAATTAATTTGAAAGTGAATTGTTTAAAGTAATTGAAAGGT
GCTAAGGATAACAACCTCAATAGAAAATGCATAGAAGAGCTGAAGAAATCGTTAGAGCTT
GAACCAAATAATGTTTTGACTCTTTTCAATATCGCAACTTGCTATTATGAGTTGAGTGAT
TATAAAAACGCTATTAAATATTATGAGATGCTAAGTAAATAAAATTTTTAAGATGCCAGA
GTGTATTTTAACCTAGCTCTTTCTTATGAAAAAATTAATGATACTTACAATGCTTAAGTG
AACTATGATAAGACACTAAAATTAAATAGCTCTTTCAGTGGGGCTGTAGTAAATTATAGC
AACTTGCTGATTCGTATAGGGGAATTAGAGCAGTCAAGACTTTTGCTAGAAAGTCATTTA
AAATACTAGCCAAGAGATGAAAAAGCTATCAATAATTTAAACATTATCTTAGCTGAAAAA
AGATAAGATAAATAGGCCGATATTCTTTTTAAAAAGATTCTTAGAAAGTAAAATGGATTC
ACTCCTTCTATTCTTTACAATCATGGTGTCTTACTCTTTAAATAAAATAAGTTAATATCT
GCCCTCCAGGCCTTTTAGTAATTTACTTAAATCCCAGAAGTTGAAGAAAGAGATCCTTTA
AATCTACTCTCGTATGTTAATCAAGGACTTATTTTTGAAAAATTAGGATAATATGAAAGC
TCATTAACTGTATACGAGACAATTTTAGAAAATTTTAGTGACATAGTTAACTGCAAGGAG
TTTGAATAGAAGATAGCAGAAATGAAAGATAAAATACTTAAAAGGCTCTCAACAAAAAAT
TATCATTTTTCTTATAACAATCCTCCACCTCAAGGATAGTAATATACTTTTTATTCTTCT
AGCTAAAATCATGATACTATGCCTCCTTTGAACTCATAACAAAAAAGACTCTTCCCTGTC
AAATAGAAAGGATCTCAATCAAATTAATTTTAACTGAGCTCCAATAATTTCCGCTAAATC
TAAACTCCACAATCTTTAGAATCAAATGGAACAAAAATTCTATTTAACTAGAAGTAAAAT
GAAATGGCATAAACTGATGGATTAAAAGGATTTAATAAAGGTTCTTTCTAATTTTAATTA
AAAACATAATAAATAAATAAATTATCTCCTGATAGCAAGAAAGATGACATCAAAATTAAT
AATTTCTTTAAAAATAATAAATTTAAAAATAGTGATAATCTCAATAATAATAATAATAAT
CATTAAGGAGAAAGAATTATTTTAGAAAAGCCTTTAACGGGATAAAATAAACAAAATTTA
TCTATTTCTTTTCATGAAAATAAGTTTAAAAAGAATATTTTATTAAGAAAGGGATCTTCT
GAACTAAAGACATCACTTAATTCACATAGTGATAAATAAAACTTAAGTAATAATTATGGA
GGAAATATGACTTAACCAAATAGAGAAGGTAGATAATTTAATTTTAATTATTTAGATAAG
CTTTCAAAACCTAAAAAACTACCTAAAGAAGATCCTAATGTTAAATCCTCTTTAGAATTA
GCTCCAAAGTAGATAAATAAGAATTGGAGTTAGCAAAATTAGGTAAACAACCCAGTATTT
GATAGACTTACTAAACCAAAATAACCTTAAGTTGAGCTAAGTTAATCTCCAGAAAGCAAT
AAAACGTTATTAAATGCTCATAAATAAAACTAAACCAAAGAGTCAAATTCTAATTTTACA
ATTAAGCCTAACTAATAAATTAAGCTTGCTAGTATTGATAGCAGCAAATAAATTTAGTAA
AAAGCAGAAAATTAAATTTCAAAAAAGGATAACAATTCTATGGCAGCTGAGAGTAGCTAA
ACTAGCATAAAGTAAAATAATTTAATGAACTTAGATAATTAATAAAAATCTAAGCCCTAA
GTTAAAAGTGAATTTGCAATTAAGCAGAGTGATTCATAAAGTAAAATTAAACAAACAAAA
AGTTAAGAAAGAAGTGAAGAAAAAGAAAAGTAAATAAGTGTAACTGATAAAAGCTAAAAT
GCTTAGAATTCTGCATAAAACCCAAAATAATAGTAATCTAATTTAGATCAGTAAAAATAA
GTAAATGGGTAAACTCAAAAAATAAATAATTCTGATAATTAAGTAAATTTAGAAGACAAA
ACACCTCTAAAAATTCAAGAGAACTCAAAAATTACAATTTAAAAAAATAACAATGTAGCA
TCTTAAAGTGTTTCTAAAGCTTCAGAATAATAATTTTCACAAACCTCCACTCCTTCTAAA
AAACAAAATTAGAAAAATTCAGAAACACCATAAAACTAGTCGACTCCTAAACAAAAAGTT
TTATCAAACTAGCCTGAAAAGGTTTAAACACCTTAAAGTTAAAAGTAATAAAAAGCTTAT
GCCGAAGACTAAAATTAAAATAAGAAAGTGAATAACTAATAAATTAATAAATAGAATTCA
ATAGGCTCATAAAAATCCCTCAAAGAAACAAATAATTTATCTTCAACTCCTATCTAACAT
TAAAAAATTAAAGAAGAAAAAGAAGAAGATGATATATCCAGATAATAGTCAGAAAGTGGA
TTAAATTCACCTAATTAAGCTGATTAGCATGGGAAACAAAAAGAATAGAATTTTACTTCA
GAATCTCTAAAATAAGATTAAATCTAAAAAGATAATTAGAAAGGAGAAAGCAAGCATTCA
ACATTTAAAGAAAATAACCCATAATAAGAATAAGAAAGAAAGTAAAGCTTGATATAAAAA
TAAATAGAAATTAATGAAACTGAAAAAAAACCAAATATTCAAAAGATAGAGAAAGAATAG
AATTAAAGTCTTGTAAAAGATGAATAAAATACAAACAATTAGTAAAATACCAATCAAAAC
AAAGATGATCAGGTAAAGGAAATGAAAGTTGAATAATAAAAAGACAATTAAAATGATATC
TCTAAAAATTAATTAGATCAAAATAGTTAATAAATAAAAGAATAATTAAAAAATAAAAAT
ATAAATGATAAAAATAATCATGAAACTAATTAGAATGAGCATAGTTAAAAAGAAAACAAA
GTAGAAGAAACAAAAAATAAAAAAGAAGGAGTTGTAAGTAAGGATGAAACCTAAGATAAC
TTGAGTAATAATTAATCAGCTATCAGCAAAAAAGAAGTAGAGTTAGATAAAAAGGATAAA
ACTGATTAATAGAATACAAAATAGTAGGTTGAGGAGAAGCATCCTGAAAGACATGAAAGT
AATTAATAAATTGAAAGTAGTGTAAAAGAAAATAGAGTTTAGGATCAATAATAAGATAAT
ACCAAGCATTAGTAGAAAGAGTAAGTTATGTAAAATTAAGATAAGAATGAATAGTAAAAA
CAAGATTAGTAATAAAAAAATTCCGAATAGATAATATAAAAAAAATAGAGTGATTAAACT
CCAAATTAAAAGAAAATTGACAAAAAAAGCACTTTTGAAGAGAAAGAAGAAAATAGTAGT
TAATAATTAATTAAAGATCATTAAGAAAGCATTAAAGAAAATAATACTAGCTAGCCACTT
ATTTAGTTGTAATAATAATATAGTTCGATGGATTCTCGACACCATGGAGAAGGATAAAGA
TCAAGACATTAGATAGGTTTTTAAATAAATATAATTTAAGAAAATGGTAGCTTGATAAAA
AGCGAAGAATTTAAAGAAGAAGTTTAAGATGATGACCCTGAATAGCTTAATGATTCTTAA
ATCCTAAAAGACAAATAACTTATTGAAGTTTAATAACAAAAAGATGTTAAAAGTGATAAT
TAAATACCTAAAGGTGAATAAAAAGAATCCAATCATGATAAAGATAAAAATTAAGAAAAA
TAACATTAAAATGAATCTAAAAACATTCCAACTATTCATTAAGATAGTTAAAATTAAAAA
AATAAAGATTTAAAAGAAATGTCAGAAAATAACTTAAATAAAAAATAAGAAATATCTAAA
AGTACAGAAGACATGAAGTAATCAACAGAGCATCCATAATAAAAGGAATCAAAAGATAGT
GCAGAATTCTAATAATAAGTTAAATCTAAAAAATCTGTAGATAATGATTAAGATAAAAAA
CATGAAGAAAAGTAAGAATCGAAAATATTAGAAGATAGTAATTAAGAAAAAGATGTTCAA
ATTAACCATTAATAAAATAATAATTAATAAATTAAATCTAAAAATGTAATAAACGAAGAT
GAAGCCAAAAAAGAAAATAATTAAACAATCAATTAGTAAGAATAAGCGCCTAAATAAAAT
AATAATAATTCCCAAGAGCAAATACCTGTTTAAGTAGAAAATTAAAATTCTCATTAAGAA
CATAAAAAATAAGAATAAGAAACTATTTAAAATAATTTAGAAAATCAAAATAAACATCAT
TAATTTGATAATTAAAATGATCATTAATAGGAAATAGAGTAAAATTAGAAATAAAAAAAT
GATTCCCCAAAAAATTTAAATTAATCTCATGAAGAGTAAAATTTTGAAAATTCTATGAAA
TAGGATTAAAAGTAAGAAGATAAAACATAAATCCCATAAACACCTAAAAAAGAAAAGATG
TAACTGTAATAAAATGACATCTCAGATAAAGATAATATCAATTTTTTTAAAGATTAAAAT
AATAATTAATAACTTGATGAAGAATAGTAGAGAATATTTAATGAATAATTAGAAAAATAA
TAAGAGTATATGATCATGGTAACATAATATAAATCTGTTGAAAAATTAAACGAAAGCTTA
TAGGATTCTGCTAGATCTAGTAAATTAAATAATATAAGTTAAGAAATTGCACATAATAAT
TAAAATTAAGATTTTATTATTGGAGGTTAAACAGAAAGTATTTAAGAAATAGAGCATCAT
TAAGATAAACATATTGATTCATAAAAATAAGATTAATCTGATTTAAATTAAGAGGAATTA
TAATAGAAATAACAATAAATACATGACGATAAAGGTGATAACAACAATATTTCTGAAAAC
CCTAATGAAATTTTAGAAAATTAATAAGAGAAAGAAATTAAAATTATAGAACAAAATCAT
GATAGTTAATAAAATGAAAAAGACAGTTAATAAATAACATAAATTGATCAAATAAACTAG
GATAATTAATAAGAAAATAGTAAGCAAGCATCGTAAATTCAAATTTAAGATCAGAAATAA
ATCAAATAAGATAATATTAATGAGTCAGATCAAGCTCATGAATAAGAAAAAGAAGATGAA
AATGAATAATTGGAAGATGAGTAAAGTTAAAACGAAGAAATTGAAAATAATTAATAAAAT
AGAGACAATGATTCAGAAAAAAATCTAAATGATAGTACATCAAAATTATAAGAAGTATAA
GATAAGCTAAATAGTGAAAAAGAAATCTAAGATTAATAAAAAATAGAATAATCAATAAGC
TAAGATGAAAAAGAATAGTAATAGCATGAATAAATCCAAGATAATAATTAATCAAATGAG
TAAATAATAAATTAAGATGAATAAGAAGAATAAAATTAGAATGAATAAACACAATTTAAT
TAATAAGAGTCAAAAGACGAGTTAAATTAAAACTAAAATTTGAAATAAGAGTAAGATGAT
TAATAAGCATAAGATTTATAACTTAATTAACAAGATGAATAACAATAACACGATGAATTG
CAAGAAAAAGATCAAAATTCTCCATAAAACTAGTAAGAATTAGATTAATAGTAAAATTTA
TAAGGTTAAGATTAGAATGAAGAGTAAAGCAATATTGAAAATAAAGAAGACTTAGATAAA
GAGAATTAAGATTAATAAGATAATGATGAATAAGAAAAATAATAAGATGAATAAGAATAA
AATTCTGAGATTAAAAATTAGGAAGATTAGCAAGAAAGAAGTAATGAAGATTAATAGGAA
TAGTTGGATAAAGATGAAAATCAATAAAATTAGGAAGAATCAAATAAATAATAAAATTTA
GAAGAAGAATAATAATAAGACTAAAATTAGGAAAATTAAATAGAAAAACAATTAGATGAT
TAACAATAAGATGCTGATTAAGAAGAATAAGCTTAGGATGTTGAAAAAGATTAATCTGAA
AATAAAGAAGAATCTGAAGCCCAACCTGTTATAAATGAAAATGATAAGAATGATACAGTT
TTGAATTAATAAGATGAAATAAAACCTAATGATCATGAGTAATAATAAGATTTAGAAGAT
ACATAAAAGGCATCATAATTAAATGGAGATGAAGAAAATGACTAAAAAGAAGAAAAATAA
GATAATATTGAAGAAAATAAAGAACAGCAAGTTCTCTAAATTAATAAAGATGATAATTAA
GAAAATTTGATCTCTAATGCTTTAGAAAACCAGGAAAATTAACAGAACATTTAAAATATT
GAAGGATTAGAATAGTAAGGAAGAACTTAATCTGAAGAGTAAGATATTGTTAAAATGCTT
TAAGGTGAGAAATCCCCTCCTTCTAAAAGCAAATCCTAAGAAGATAACGTACTCGAGAAT
GATAATCACTAAAATTAATATTTAGTCAATAAACTAATTTAAAATAACTCTAATGACGAA
GAAAATGAGAAAAGAGGGCTCCTTACTTTACACAGCTCTGCTAAAGAATTAGAATCTAAC
AGAGACTCTTTTATGAGTGATAATAATCTTACAAAAAAAAGTAAAAGTAAAAAGAGTAAG
AAAAATCTCTAATCATAATTACCCCCTGAATTTGATTCATGGACTAAGTAAATATGTGAA
AATATGATTAGAAACTAAGACGAAAAGGCTTATATGGCTCATTATAAATTAGGTATAATT
TCGATTGAAGATAATGATGTTGAAAATGCAAAGTTAAACTTCTTAAAGGTGGCTGAGTTA
TAGCCTGATTTCATGCCTGAAAGAATTCATTTTGCAATAGCAGAAATATTCCTTCAAACA
TAAAATTGGGAATAAGCTTTAGAACACTATAAAATTTAATACAAATATTCTCAAGATAAA
TATACCTCTTGCTTAAGAATCGGAAAGTGCTTTAAAAAGCTTAATAATTTAGAGAAAGCT
AAAAAAAGCTTTGAAAACGCTATTGCTTAAAATGACTAAAAAGACTATAAATGCTTTTAC
AAACTTGGTTCAATTTTCTTTTAAGAAAACAAAGTTAAAGAAGCCATAGATAATTTTTCT
AAGGCTCTTTCTCTGAACGCTTAGGATATTAAAATATTAGTAAAGCTTGGACAGATTTAT
TTAGAGTAAGATAAAGAAGAAAATAGTATTTAAGAAGCTTTCTAATACCTCACTGATGCT
ATACAGTTAGATGAAAATAATTATGAGTGTTTGATAAGTTTAGGAAAACTCTATGATAAA
TAGGGAGAATTAGAAAATGCAATTAAATTCACAGAACTTGCTATTTAGAGGCCTGAACAC
AATATAAATTCAATGTATTACCTAGGCACATTATACCTTAAAAATAAAGAAATAACTAAG
TCCGGAGAATGTTTCAAAAAAGTTTTATAATAAAATTCAGAACATATCCCAAGTTTGATA
GAATATGCTACTATTTTAAGCTTGAAAGGAGAATTTGAGAAATCAAAAAAATACTTTAAA
ATAGCTCTTTCCAAAGATCCTAATAATTTAATTTGCAATTTAAGACTAGGCAAGATATAT
TTAAATAAGCTTAACAATATAAATCGTGCTATTGATTGCTTCAAGCAAATTATAAGCATC
GAACCTAAGTATAGTAAGGCACATTTCTAGCTGGGTATGGCATACCAATCGAGAAAAGAT
TTTAAATTGGCAGCTGAGTGCTTTAAATAATGTATAAGTATAAATCCTAATAATGCAGAT
GCATGGTAGTAGCTAGGTACCATATTTTAAGAAACTGGTAACACTGAAAAGGCTCTTATG
TATTTCCAAAAGGGTTTAGTTTTTAATCCAAATGATTTTTAACTTCAGAAAGGAATTGCT
AACTGTTATTATTTTACTGAAAATTATGATACAGCAATAGAAAAATATGAGAACCTCTTA
AAGAATAAATAAGATGATGAAGCATTACAATATCTAGCTGACTGCTATTACACTAAAGAT
GATGTGGAAAATGCTATTTACTATTACAAATAATGTCTTGAAATTAACCCCAAAAGACCT
AATTGCTTATATAATTTAGGTAATGCATATTGTACTTAAAATAACTATGAAGAGGCCTAG
TAAGCCTACATAGAGTGTATATAATTAGATACTACTAATGCTTCTGCATATTATAATTTG
GCAAATGTATATTACATTTAAAATGATTACGAGAACGCTTTGATTAATTTTGAATTAGCC
ATAGAAAAAGACCCTTCAAATGTTGAATGGAGAAATTATATTGCAGGATTGTATATAGAT
AATAATTAATTTGATAAAGCAATATAACATTTACTTAAAGCATATGATGATGGTACAAGC
AACTTTGATACATGCTTTAAACTTGCTTAGGCTTACTACGGACAATAAAATTTATCCGAA
GCACGTCAATACATAAAGGTTGCTGTAGAGATAGATCCAGATAATGATGATGCATATAGA
TTATATGAAGAGCTTAATCCTGCTCCAGTTAACAAAAGTAATAGTCAAAACAAAGACTCT
AATGTTTCAGCCTCTAAGGATTTAGAGTCAGATGCAAGTTAAATAAAATACAGTTAAGCA
TCTATTTAGGTTTTCAAAGAAAACATGGATCTATCTATAAGATAAGAAAGAAATGGCAAA
TCATATAATAAAGGTAGCTAATCACGTATTTTAAAAGAAAATATTGAATGA


>TTHERM_00441970(protein)
MSDYDYEQDFSDLNDEKPQSQEIERHEDSQFQQNQAVSPREGQNSQNNGELEKDSDFGAN
HSYVSFSHEEKEIVEKQIHQNSKQSKLFTDTSEEFNKIRSNIIEKQFQQALVQIEEYLRL
NPKSVEAINLKVNCLKQLKGAKDNNLNRKCIEELKKSLELEPNNVLTLFNIATCYYELSD
YKNAIKYYEMLSKQNFQDARVYFNLALSYEKINDTYNAQVNYDKTLKLNSSFSGAVVNYS
NLLIRIGELEQSRLLLESHLKYQPRDEKAINNLNIILAEKRQDKQADILFKKILRKQNGF
TPSILYNHGVLLFKQNKLISALQAFQQFTQIPEVEERDPLNLLSYVNQGLIFEKLGQYES
SLTVYETILENFSDIVNCKEFEQKIAEMKDKILKRLSTKNYHFSYNNPPPQGQQYTFYSS
SQNHDTMPPLNSQQKRLFPVKQKGSQSNQFQLSSNNFRQIQTPQSLESNGTKILFNQKQN
EMAQTDGLKGFNKGSFQFQLKTQQINKLSPDSKKDDIKINNFFKNNKFKNSDNLNNNNNN
HQGERIILEKPLTGQNKQNLSISFHENKFKKNILLRKGSSELKTSLNSHSDKQNLSNNYG
GNMTQPNREGRQFNFNYLDKLSKPKKLPKEDPNVKSSLELAPKQINKNWSQQNQVNNPVF
DRLTKPKQPQVELSQSPESNKTLLNAHKQNQTKESNSNFTIKPNQQIKLASIDSSKQIQQ
KAENQISKKDNNSMAAESSQTSIKQNNLMNLDNQQKSKPQVKSEFAIKQSDSQSKIKQTK
SQERSEEKEKQISVTDKSQNAQNSAQNPKQQQSNLDQQKQVNGQTQKINNSDNQVNLEDK
TPLKIQENSKITIQKNNNVASQSVSKASEQQFSQTSTPSKKQNQKNSETPQNQSTPKQKV
LSNQPEKVQTPQSQKQQKAYAEDQNQNKKVNNQQINKQNSIGSQKSLKETNNLSSTPIQH
QKIKEEKEEDDISRQQSESGLNSPNQADQHGKQKEQNFTSESLKQDQIQKDNQKGESKHS
TFKENNPQQEQERKQSLIQKQIEINETEKKPNIQKIEKEQNQSLVKDEQNTNNQQNTNQN
KDDQVKEMKVEQQKDNQNDISKNQLDQNSQQIKEQLKNKNINDKNNHETNQNEHSQKENK
VEETKNKKEGVVSKDETQDNLSNNQSAISKKEVELDKKDKTDQQNTKQQVEEKHPERHES
NQQIESSVKENRVQDQQQDNTKHQQKEQVMQNQDKNEQQKQDQQQKNSEQIIQKKQSDQT
PNQKKIDKKSTFEEKEENSSQQLIKDHQESIKENNTSQPLIQLQQQYSSMDSRHHGEGQR
SRHQIGFQINIIQENGSLIKSEEFKEEVQDDDPEQLNDSQILKDKQLIEVQQQKDVKSDN
QIPKGEQKESNHDKDKNQEKQHQNESKNIPTIHQDSQNQKNKDLKEMSENNLNKKQEISK
STEDMKQSTEHPQQKESKDSAEFQQQVKSKKSVDNDQDKKHEEKQESKILEDSNQEKDVQ
INHQQNNNQQIKSKNVINEDEAKKENNQTINQQEQAPKQNNNNSQEQIPVQVENQNSHQE
HKKQEQETIQNNLENQNKHHQFDNQNDHQQEIEQNQKQKNDSPKNLNQSHEEQNFENSMK
QDQKQEDKTQIPQTPKKEKMQLQQNDISDKDNINFFKDQNNNQQLDEEQQRIFNEQLEKQ
QEYMIMVTQYKSVEKLNESLQDSARSSKLNNISQEIAHNNQNQDFIIGGQTESIQEIEHH
QDKHIDSQKQDQSDLNQEELQQKQQQIHDDKGDNNNISENPNEILENQQEKEIKIIEQNH
DSQQNEKDSQQITQIDQINQDNQQENSKQASQIQIQDQKQIKQDNINESDQAHEQEKEDE
NEQLEDEQSQNEEIENNQQNRDNDSEKNLNDSTSKLQEVQDKLNSEKEIQDQQKIEQSIS
QDEKEQQQHEQIQDNNQSNEQIINQDEQEEQNQNEQTQFNQQESKDELNQNQNLKQEQDD
QQAQDLQLNQQDEQQQHDELQEKDQNSPQNQQELDQQQNLQGQDQNEEQSNIENKEDLDK
ENQDQQDNDEQEKQQDEQEQNSEIKNQEDQQERSNEDQQEQLDKDENQQNQEESNKQQNL
EEEQQQDQNQENQIEKQLDDQQQDADQEEQAQDVEKDQSENKEESEAQPVINENDKNDTV
LNQQDEIKPNDHEQQQDLEDTQKASQLNGDEENDQKEEKQDNIEENKEQQVLQINKDDNQ
ENLISNALENQENQQNIQNIEGLEQQGRTQSEEQDIVKMLQGEKSPPSKSKSQEDNVLEN
DNHQNQYLVNKLIQNNSNDEENEKRGLLTLHSSAKELESNRDSFMSDNNLTKKSKSKKSK
KNLQSQLPPEFDSWTKQICENMIRNQDEKAYMAHYKLGIISIEDNDVENAKLNFLKVAEL
QPDFMPERIHFAIAEIFLQTQNWEQALEHYKIQYKYSQDKYTSCLRIGKCFKKLNNLEKA
KKSFENAIAQNDQKDYKCFYKLGSIFFQENKVKEAIDNFSKALSLNAQDIKILVKLGQIY
LEQDKEENSIQEAFQYLTDAIQLDENNYECLISLGKLYDKQGELENAIKFTELAIQRPEH
NINSMYYLGTLYLKNKEITKSGECFKKVLQQNSEHIPSLIEYATILSLKGEFEKSKKYFK
IALSKDPNNLICNLRLGKIYLNKLNNINRAIDCFKQIISIEPKYSKAHFQLGMAYQSRKD
FKLAAECFKQCISINPNNADAWQQLGTIFQETGNTEKALMYFQKGLVFNPNDFQLQKGIA
NCYYFTENYDTAIEKYENLLKNKQDDEALQYLADCYYTKDDVENAIYYYKQCLEINPKRP
NCLYNLGNAYCTQNNYEEAQQAYIECIQLDTTNASAYYNLANVYYIQNDYENALINFELA
IEKDPSNVEWRNYIAGLYIDNNQFDKAIQHLLKAYDDGTSNFDTCFKLAQAYYGQQNLSE
ARQYIKVAVEIDPDNDDAYRLYEELNPAPVNKSNSQNKDSNVSASKDLESDASQIKYSQA
SIQVFKENMDLSIRQERNGKSYNKGSQSRILKENIE


>TTHERM_00441970(gene)
ATGTCAGATTATGATTATGAATAGGATTTTAGCGATTGTAAAACTTAGATTAATTTAATC
ATACCTTATTAGTTCATAAATTAGATGAAACGGTTTATAAATTCTAAAGTTTTTTTTGTA
AACTTAAAACAGTGAATGATGAAAAACCTTAATCGTAGGAAATCGAAAGGCATGAAGATT
CTTAATTTCAATAAAATTAAGCAGTTTCACCTAGAGAAGGACAAAACTCTTAAAATAATG
GTAGAGAACTAACTATAAATTAATTATTTATTTATTAGATGAATCGACACCATAGGTGTA
ATCAATAAAATATTTATATATATTAGGAGAATTAGAAAAGGATTCTGATTTTGGAGCGAA
TCATTCATACGTGTCATTTTCTCATGAAGAAAAGGAAATTGTTGAAAAATAAATTCATTA
AAATAGTAAACAGAGTAAACTATTTACAGATACTTCAGAAGAATTCAATAAAATTAGATC
AAACATAATAGAAAAGCAATTCTAATAAGCAGTAAATATTAATTAATTTTCTTATAAAGC
AATTAAAAGAGAATTATTATCAAAAAGAGACTAATATAAAATAAAAAATTTAAAATAATT
ATTAAATATTATTTCAAAATATTTCATTTAAAGCTTGTCCAAATTGAAGAGTATTTAAGA
TTAAATCCAAAAAGTGTTGAAGCAATTAATTTGAAAGTGAATTGTTTAAAGTAATTGAAA
GGTGCTAAGGATAACAACCTCAATAGAAAATGCATAGAAGAGCTGAAGAAATCGTTAGAG
GTAATAAATTAAATTTCATTATTGAATATAAAGCAATTTATATTGCAAATAAGATTCTCA
AATTCATTATTCAAAAATGAAGTAATTAATATTTTTCTAAATGAGAATTGCAAAATCTTT
CATAATCTAGTGAGAATTTAAAATAGATAGATTGATTATTAGTTTAAAAAAATTAAGTAT
TTTTATTTAAAAAATAATACTTAAGCTTGAACCAAATAATGTTTTGACTCTTTTCAATAT
CGCAACTTGCTATTATGAGTTGAGTGATTATAAAAACGCTATTAAATATTATGAGATGCT
AAGTAAATAAAATTTTTAAGATGCCAGAGTGTATTTTAACCTAGCTCTTTCTTATGAAAA
AATTAATGATACTTACAATGCTTAAGTGAACTATGATAAGGTAAATAAATATTTAGCATA
GTTATTTATTTAAAAATTTTATTTTTAATAACTAAAAGACACTAAAATTAAATAGCTCTT
TCAGTGGGGCTGTAGTAAATTATAGCAACTTGCTGATTCGTATAGGGGAATTAGAGCAGT
CAAGACTTTTGCTAGAAAGTCATTTAAAATACTAGCCAAGAGATGAAAAAGCTATCAATA
ATTTAAACATTATCTTAGCTGAAAAAAGATAAGATAAATAGGCCGATATTCTTTTTAAAA
AGATTCTTAGAAAGTAAAATGGATTCACTCCTTCTATTCTTTACAATCATGGTGTCTTAC
TCTTTAAATAAAATAAGTTAATATCTGCCCTCCAGGCCTTTTAGTAATTTACTTAAATCC
CAGAAGTTGAAGAAAGAGATCCTTTAAATCTACTCTCGTATGTTAATCAAGGACTTATTT
TTGAAAAATTAGGATAATATGAAAGCTCATTAACTGTATACGAGACAGTAATTAATTATT
AATATATTTTTTTTTCTTCAAAAATTTCGTGTTTAATTAAAAATTATTTATTTAAAAAGA
TTTTAGAAAATTTTAGTGACATAGTTAACTGCAAGGAGTTTGAATAGAAGATAGCAGAAA
TGAAAGATAAAATACTTAAAAGGCTCTCAACAAAAAATTATCATTTTTCTTATAACAATC
CTCCACCTCAAGGATAGTAATATACTTTTTATTCTTCTAGCTAAAATCATGATACTATGC
CTCCTTTGAACTCATAACAAAAAAGACTCTTCCCTGTCAAATAGAAAGGATCTCAATCAA
ATTAATTTTAACTGAGCTCCAATAATTTCCGCTAAATCTAAACTCCACAATCTTTAGAAT
CAAATGGAACAAAAATTCTATTTAACTAGAAGTAAAATGAAATGGCATAAACTGATGGAT
TAAAAGGATTTAATAAAGGTTCTTTCTAATTTTAATTAAAAACATAATAAATAAATAAAT
TATCTCCTGATAGCAAGAAAGATGACATCAAAATTAATAATTTCTTTAAAAATAATAAAT
TTAAAAATAGTGATAATCTCAATAATAATAATAATAATCATTAAGGAGAAAGAATTATTT
TAGAAAAGCCTTTAACGGGATAAAATAAACAAAATTTATCTATTTCTTTTCATGAAAATA
AGTTTAAAAAGAATATTTTATTAAGAAAGGGATCTTCTGAACTAAAGACATCACTTAATT
CACATAGTGATAAATAAAACTTAAGTAATAATTATGGAGGAAATATGACTTAACCAAATA
GAGAAGGTAGATAATTTAATTTTAATTATTTAGATAAGCTTTCAAAACCTAAAAAACTAC
CTAAAGAAGATCCTAATGTTAAATCCTCTTTAGAATTAGCTCCAAAGTAGATAAATAAGA
ATTGGAGTTAGCAAAATTAGGTAAACAACCCAGTATTTGATAGACTTACTAAACCAAAAT
AACCTTAAGTTGAGCTAAGTTAATCTCCAGAAAGCAATAAAACGTTATTAAATGCTCATA
AATAAAACTAAACCAAAGAGTCAAATTCTAATTTTACAATTAAGCCTAACTAATAAATTA
AGCTTGCTAGTATTGATAGCAGCAAATAAATTTAGTAAAAAGCAGAAAATTAAATTTCAA
AAAAGGATAACAATTCTATGGCAGCTGAGAGTAGCTAAACTAGCATAAAGTAAAATAATT
TAATGAACTTAGATAATTAATAAAAATCTAAGCCCTAAGTTAAAAGTGAATTTGCAATTA
AGCAGAGTGATTCATAAAGTAAAATTAAACAAACAAAAAGTTAAGAAAGAAGTGAAGAAA
AAGAAAAGTAAATAAGTGTAACTGATAAAAGCTAAAATGCTTAGAATTCTGCATAAAACC
CAAAATAATAGTAATCTAATTTAGATCAGTAAAAATAAGTAAATGGGTAAACTCAAAAAA
TAAATAATTCTGATAATTAAGTAAATTTAGAAGACAAAACACCTCTAAAAATTCAAGAGA
ACTCAAAAATTACAATTTAAAAAAATAACAATGTAGCATCTTAAAGTGTTTCTAAAGCTT
CAGAATAATAATTTTCACAAACCTCCACTCCTTCTAAAAAACAAAATTAGAAAAATTCAG
AAACACCATAAAACTAGTCGACTCCTAAACAAAAAGTTTTATCAAACTAGCCTGAAAAGG
TTTAAACACCTTAAAGTTAAAAGTAATAAAAAGCTTATGCCGAAGACTAAAATTAAAATA
AGAAAGTGAATAACTAATAAATTAATAAATAGAATTCAATAGGCTCATAAAAATCCCTCA
AAGAAACAAATAATTTATCTTCAACTCCTATCTAACATTAAAAAATTAAAGAAGAAAAAG
AAGAAGATGATATATCCAGATAATAGTCAGAAAGTGGATTAAATTCACCTAATTAAGCTG
ATTAGCATGGGAAACAAAAAGAATAGAATTTTACTTCAGAATCTCTAAAATAAGATTAAA
TCTAAAAAGATAATTAGAAAGGAGAAAGCAAGCATTCAACATTTAAAGAAAATAACCCAT
AATAAGAATAAGAAAGAAAGTAAAGCTTGATATAAAAATAAATAGAAATTAATGAAACTG
AAAAAAAACCAAATATTCAAAAGATAGAGAAAGAATAGAATTAAAGTCTTGTAAAAGATG
AATAAAATACAAACAATTAGTAAAATACCAATCAAAACAAAGATGATCAGGTAAAGGAAA
TGAAAGTTGAATAATAAAAAGACAATTAAAATGATATCTCTAAAAATTAATTAGATCAAA
ATAGTTAATAAATAAAAGAATAATTAAAAAATAAAAATATAAATGATAAAAATAATCATG
AAACTAATTAGAATGAGCATAGTTAAAAAGAAAACAAAGTAGAAGAAACAAAAAATAAAA
AAGAAGGAGTTGTAAGTAAGGATGAAACCTAAGATAACTTGAGTAATAATTAATCAGCTA
TCAGCAAAAAAGAAGTAGAGTTAGATAAAAAGGATAAAACTGATTAATAGAATACAAAAT
AGTAGGTTGAGGAGAAGCATCCTGAAAGACATGAAAGTAATTAATAAATTGAAAGTAGTG
TAAAAGAAAATAGAGTTTAGGATCAATAATAAGATAATACCAAGCATTAGTAGAAAGAGT
AAGTTATGTAAAATTAAGATAAGAATGAATAGTAAAAACAAGATTAGTAATAAAAAAATT
CCGAATAGATAATATAAAAAAAATAGAGTGATTAAACTCCAAATTAAAAGAAAATTGACA
AAAAAAGCACTTTTGAAGAGAAAGAAGAAAATAGTAGTTAATAATTAATTAAAGATCATT
AAGAAAGCATTAAAGAAAATAATACTAGCTAGCCACTTATTTAGTTGTAATAATAATATA
GTTCGATGGATTCTCGACACCATGGAGAAGGATAAAGATCAAGACATTAGATAGGTTTTT
AAATAAATATAATTTAAGAAAATGGTAGCTTGATAAAAAGCGAAGAATTTAAAGAAGAAG
TTTAAGATGATGACCCTGAATAGCTTAATGATTCTTAAATCCTAAAAGACAAATAACTTA
TTGAAGTTTAATAACAAAAAGATGTTAAAAGTGATAATTAAATACCTAAAGGTGAATAAA
AAGAATCCAATCATGATAAAGATAAAAATTAAGAAAAATAACATTAAAATGAATCTAAAA
ACATTCCAACTATTCATTAAGATAGTTAAAATTAAAAAAATAAAGATTTAAAAGAAATGT
CAGAAAATAACTTAAATAAAAAATAAGAAATATCTAAAAGTACAGAAGACATGAAGTAAT
CAACAGAGCATCCATAATAAAAGGAATCAAAAGATAGTGCAGAATTCTAATAATAAGTTA
AATCTAAAAAATCTGTAGATAATGATTAAGATAAAAAACATGAAGAAAAGTAAGAATCGA
AAATATTAGAAGATAGTAATTAAGAAAAAGATGTTCAAATTAACCATTAATAAAATAATA
ATTAATAAATTAAATCTAAAAATGTAATAAACGAAGATGAAGCCAAAAAAGAAAATAATT
AAACAATCAATTAGTAAGAATAAGCGCCTAAATAAAATAATAATAATTCCCAAGAGCAAA
TACCTGTTTAAGTAGAAAATTAAAATTCTCATTAAGAACATAAAAAATAAGAATAAGAAA
CTATTTAAAATAATTTAGAAAATCAAAATAAACATCATTAATTTGATAATTAAAATGATC
ATTAATAGGAAATAGAGTAAAATTAGAAATAAAAAAATGATTCCCCAAAAAATTTAAATT
AATCTCATGAAGAGTAAAATTTTGAAAATTCTATGAAATAGGATTAAAAGTAAGAAGATA
AAACATAAATCCCATAAACACCTAAAAAAGAAAAGATGTAACTGTAATAAAATGACATCT
CAGATAAAGATAATATCAATTTTTTTAAAGATTAAAATAATAATTAATAACTTGATGAAG
AATAGTAGAGAATATTTAATGAATAATTAGAAAAATAATAAGAGTATATGATCATGGTAA
CATAATATAAATCTGTTGAAAAATTAAACGAAAGCTTATAGGATTCTGCTAGATCTAGTA
AATTAAATAATATAAGTTAAGAAATTGCACATAATAATTAAAATTAAGATTTTATTATTG
GAGGTTAAACAGAAAGTATTTAAGAAATAGAGCATCATTAAGATAAACATATTGATTCAT
AAAAATAAGATTAATCTGATTTAAATTAAGAGGAATTATAATAGAAATAACAATAAATAC
ATGACGATAAAGGTGATAACAACAATATTTCTGAAAACCCTAATGAAATTTTAGAAAATT
AATAAGAGAAAGAAATTAAAATTATAGAACAAAATCATGATAGTTAATAAAATGAAAAAG
ACAGTTAATAAATAACATAAATTGATCAAATAAACTAGGATAATTAATAAGAAAATAGTA
AGCAAGCATCGTAAATTCAAATTTAAGATCAGAAATAAATCAAATAAGATAATATTAATG
AGTCAGATCAAGCTCATGAATAAGAAAAAGAAGATGAAAATGAATAATTGGAAGATGAGT
AAAGTTAAAACGAAGAAATTGAAAATAATTAATAAAATAGAGACAATGATTCAGAAAAAA
ATCTAAATGATAGTACATCAAAATTATAAGAAGTATAAGATAAGCTAAATAGTGAAAAAG
AAATCTAAGATTAATAAAAAATAGAATAATCAATAAGCTAAGATGAAAAAGAATAGTAAT
AGCATGAATAAATCCAAGATAATAATTAATCAAATGAGTAAATAATAAATTAAGATGAAT
AAGAAGAATAAAATTAGAATGAATAAACACAATTTAATTAATAAGAGTCAAAAGACGAGT
TAAATTAAAACTAAAATTTGAAATAAGAGTAAGATGATTAATAAGCATAAGATTTATAAC
TTAATTAACAAGATGAATAACAATAACACGATGAATTGCAAGAAAAAGATCAAAATTCTC
CATAAAACTAGTAAGAATTAGATTAATAGTAAAATTTATAAGGTTAAGATTAGAATGAAG
AGTAAAGCAATATTGAAAATAAAGAAGACTTAGATAAAGAGAATTAAGATTAATAAGATA
ATGATGAATAAGAAAAATAATAAGATGAATAAGAATAAAATTCTGAGATTAAAAATTAGG
AAGATTAGCAAGAAAGAAGTAATGAAGATTAATAGGAATAGTTGGATAAAGATGAAAATC
AATAAAATTAGGAAGAATCAAATAAATAATAAAATTTAGAAGAAGAATAATAATAAGACT
AAAATTAGGAAAATTAAATAGAAAAACAATTAGATGATTAACAATAAGATGCTGATTAAG
AAGAATAAGCTTAGGATGTTGAAAAAGATTAATCTGAAAATAAAGAAGAATCTGAAGCCC
AACCTGTTATAAATGAAAATGATAAGAATGATACAGTTTTGAATTAATAAGATGAAATAA
AACCTAATGATCATGAGTAATAATAAGATTTAGAAGATACATAAAAGGCATCATAATTAA
ATGGAGATGAAGAAAATGACTAAAAAGAAGAAAAATAAGATAATATTGAAGAAAATAAAG
AACAGCAAGTTCTCTAAATTAATAAAGATGATAATTAAGAAAATTTGATCTCTAATGCTT
TAGAAAACCAGGAAAATTAACAGAACATTTAAAATATTGAAGGATTAGAATAGTAAGGAA
GAACTTAATCTGAAGAGTAAGATATTGTTAAAATGCTTTAAGGTGAGAAATCCCCTCCTT
CTAAAAGCAAATCCTAAGAAGATAACGTACTCGAGAATGATAATCACTAAAATTAATATT
TAGTCAATAAACTAATTTAAAATAACTCTAATGACGAAGAAAATGAGAAAAGAGGGCTCC
TTACTTTACACAGCTCTGCTAAAGAATTAGAATCTAACAGAGACTCTTTTATGAGTGATA
ATAATCTTACAAAAAAAAGTAAAAGTAAAAAGAGTAAGAAAAATCTCTAATCATAATTAC
CCCCTGAATTTGATTCATGGACTAAGTAAATATGTGAAAATATGATTAGAAACTAAGACG
AAAAGGCTTATATGGCTCATTATAAATTAGGTATAATTTCGATTGAAGATAATGATGTTG
AAAATGCAAAGTTAAACTTCTTAAAGGTGGCTGAGTTATAGCCTGATTTCATGCCTGAAA
GAATTCATTTTGCAATAGCAGAAATATTCCTTCAAACATAAAATTGGGAATAAGCTTTAG
AACACTATAAAATTTAATACAAATATTCTCAAGATAAATATACCTCTTGCTTAAGAATCG
GAAAGTGCTTTAAAAAGCTTAATAATTTAGAGAAAGCTAAAAAAAGCTTTGAAAACGCTA
TTGCTTAAAATGACTAAAAAGACTATAAATGCTTTTACAAACTTGGTTCAATTTTCTTTT
AAGAAAACAAAGTTAAAGAAGCCATAGATAATTTTTCTAAGGCTCTTTCTCTGAACGCTT
AGGATATTAAAATATTAGTAAAGCTTGGACAGATTTATTTAGAGTAAGATAAAGAAGAAA
ATAGTATTTAAGAAGCTTTCTAATACCTCACTGATGCTATACAGTTAGATGAAAATAATT
ATGAGTGTTTGATAAGTTTAGGAAAACTCTATGATAAATAGGGAGAATTAGAAAATGCAA
TTAAATTCACAGAACTTGCTATTTAGAGGCCTGAACACAATATAAATTCAATGTATTACC
TAGGCACATTATACCTTAAAAATAAAGAAATAACTAAGTCCGGAGAATGTTTCAAAAAAG
TTTTATGTAATTATTTATTTTAAAAAAATTTTTTTCTTATTCAAATGTTATTTTTAAAAG
AATAAAATTCAGAACATATCCCAAGTTTGATAGAATATGCTACTATTTTAAGCTTGAAAG
GAGAATTTGAGAAATCAAAAAAATACTTTAAGTAAATTTTTAAATTAATTTATTTTTATA
TCATTTAAATTTTTTAATAAATAAATTATTAATAGAATAGCTCTTTCCAAAGATCCTAAT
AATTTAATTTGCAATTTAAGACTAGGCAAGATATATTTAAATAAGCTTAACAATATAAAT
CGTGCTATTGATTGCTTCAAGCAAATTATAAGCATCGAACCTAAGTATAGTAAGGCACAT
TTCTAGCTGGGTATGGCATACCAATCGAGAAAAGATTTTAAATTGGCAGCTGAGTGCTTT
AAATAATGTATAAGTATAAATCCTAATAATGCAGATGCATGGTAGTAGCTAGGTATTTAT
ATATTTTAACATGATTTAAATTATTGATAATTTTTTTTTTTTAATATAAAAGGTACCATA
TTTTAAGAAACTGGTAACACTGAAAAGGCTCTTATGTATTTCCAAAAGGGTTTAGTTTTT
AATCCAAATGATTTTTAACTTCAGAAAGGAATTGCTAACTGTTATTATTTTACTGAAAAT
TATGATACAGCAATAGAAAAATATGAGAACCTCTTAAAGAATAAATAAGATGATGAAGCA
TTACAATATCTAGCTGACTGCTATTACACTAAAGATGATGTGGAAAATGCTATTTACTAT
TACAAATAATGTCTTGAAATTAACCCCAAAAGACCTAATTGCTTATATAATTTAGGTAAT
GCATATTGTACTTAAAATAACTATGAAGAGGCCTAGTAAGCCTACATAGAGTGTATATAA
TTAGATACTACTAATGCTTCTGCATATTATAATTTGGCAAATGTATATTACATTTAAAAT
GATTACGAGAACGCTTTGATTAATTTTGAATTAGCCATAGAAAAAGACCCTTCAAATGTT
GAATGGAGAAATTATATTGCAGGATTGTATATAGATAATAATTAATTTGATAAAGCAATA
TAACATTTACTTAAAGCATATGATGATGGTACAAGCAACTTTGATACATGCTTTAAACTT
GCTTAGGCTTACTACGGACAATAAAATTTATCCGAAGCACGTCAATACATAAAGGTAAAA
ATATTTTTTCTTAAATTATAAATTATAATTTTTTTTTATTCAGGTTGCTGTAGAGATAGA
TCCAGATAATGATGATGCATATAGATTATATGAAGAGCTTAATCCTGCTCCAGTTAACAA
AAGTAATAGTCAAAACAAAGACTCTAATGTTTCAGCCTCTAAGGATTTAGAGTCAGATGC
AAGTTAAATAAAATACAGTTAAGCATCTATTTAGGTTTTCAAAGAAAACATGGATCTATC
TATAAGATAAGAAAGAAATGGCAAATCATATAATAAAGGTAGCTAATCACGTATTTTAAA
AGAAAATATTGAATGA