Identifiers and Description

Gene Model Identifier

TTHERM_00440460

Standard Name

None

Aliases

PreTt05501 | 49.m00273 | 3708.m00121

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( TIGR00436 ) GTP-binding protein Era
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR01396 ) flagellar basal-body rod protein FlgB
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00440460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12383.19.997093137033517e-262hypothetical protein (650 aa)
OxytrichaContig11117.0.g22.000127961544401e-12050S ribosome-binding GTPase
DictyBaseDDB_G02942924.001540793770557e-102DDB_G0294292 on chromosome: 2
position 8123 to 10250
SGDYGL099W1.9995541014149208e-99LSG1 Putative GTPase involved
in 60S ribosomal subunit bioge
nesis; required for the releas
e of Nmd3p from 60S subunits i
n the cytoplasm
WormBaseWBGene000169079.999776257620412e-83status:Confirmed UniProt:O01
826 protein_id:CCD67947.1
Stentor CoeruleusSteCoe_200159.602680054508676e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00440460(coding)
ATGCCGAGAGTTCATAAAGCAAAAGGTACTTTAGGTCGTAACCTAATGAAAGCAATTGAG
CACAAAAACCACTCTTTTTAGCCTAAGACTGTAGATGTTCCTCGTTTTGTTCATGCTCAA
AACAATCAAGCCTAGTTAGAAAAAGGAAAGGACTTAAAATCCTGTATTGACTAAGATAAT
TTGGATGATTTCCTTTAGGTTGTTTAATTACAAAATAAAAACTTTGAAGCCTTGCGTGGT
ATGAAGCTAAAAACTGACATGAATGATAGAGAAGTTGTTATTGATGCTATCAAAGATTAA
GAAGCTATTAATGATGGTGCCTTTAACATTGAAAATAACTAATATATTCAAAATTTACGT
ATTCCAAGAAAGCCTAAGTGGACAAAAGAAATGACTAAAGATTAATTAAATGCTTTAGAA
AATTAATCTTTTGTAGAATGGAGAAAAGCTTTGGCTAAAATTGAAGAAGCTCATTATACA
ATTTAGATTACCCCTTATGAAAAGAACATTGAAGTTTGGAAATAGCTTTGGCGTGTTATT
GAAAGATCAGACATCATTGTATAAATTGTGGATGGCCGTGATCCTCTCTTTTTTAGATGT
CCTGATGTCGAAGTTTACTCTAAAGAAGTCAATGCTGATAAGCTAAATTTCTTGCTTGTT
AACAAGTCAGATTTGATATCAGATGATATTAGAAAGGAATGGTCTACCTACTTAAATGAA
TAGAATGTCTAGCACATGTTCTTTAGCGCTAAGATGGAATAAGAAAAGATTGATGCAAAT
CATGCTCAAGAAGTCAAAAATAATATTTTCTTGACTAAGGATTTAGGCTTAAACGATGAT
GAAGAAGAAGAAAAGAAAAATCAAGATAACGAAAAAACTAAATAATACTTGAATACTCCA
AATATCTGCAACAGAGAAACACTGCTTCGCACATTGAAAGAATTAGTTTAATCAGTAAAG
CAAAAGAAGAACCAAATCAAGCAAAAGAAAGAATAAGAATCTGTAGGCAATGAGCATCTT
GAAGATCAACTAATTTTAGATTAGTTAGATGAAGCTGAAAATATGAAATTTAACAAATAA
AAAATGGCTATATAAATTGGTATGGTCGGATATCCTAATGTTGGTAAATCTTCAGTTATT
AACACATTGTGTAACAAAAAACTTGTCGGAGTTGGCTCTCTTCCTGGTAAAACAAAGAAT
TTCCAAACTCACTTCTTAGAATAAGATTTGATATTGTGCGATTGCCCTGGTCTCGTTTTC
CCCAATGCAGCTTCTACTCGTGCTGAAATGGTTTGCAACGGTGTCATGCCTATTGATAAA
CTTAAAGACTATCTCAGTCCTGTTGATTTACTCTGCTCTCGTATTCCTAAAATAGTTCTT
GAAAAGTTATATAAAATAAAAATTGATGTTGAAGTTCCTGATGGTTCTTACTTCCTTTCT
AAATATGCAATTGCTAAGGGTTACTACACTGGCAGTGGTGTTCCTGATATGGCTAAGTCA
TCTAAACTTATATTAAAGGAACTTGTTTCTGGAAAGCTTCTTTACTGTAAATTGCCTCCT
ACCTGTGAAGAAAACTGCGGTATCTGGCAAAGTAACTAAATTGACATATAAGTAGGAAAT
ATTTTAGGAGATGTCAATGAGTAGGAATAAGAAGAAAAAGCTGAAAATATGGAAGCATTA
ATGGTCAACTAAGAAGAAAAAAAACTTGATTAAATGCTTTTGAAATAAGAAGCTTAGAAA
ATAGGTGATAAAATCTAGTTTGATGAAGATGACATAGTCTTCTTATTAGCAGGCAAAAAA
GTAAATGGAATTAAGCTAAATAAGTAGTAAAAAAGAGATATCAAGCACGCATATTAAAGA
GGTGAAGCTATTGATATGAAAAAATACCTAGACCAAGACCAAATATTAGAATATGGAATC
AAAAATAAAGGTATGATCCCTCCTTCATCCTGA


>TTHERM_00440460(protein)
MPRVHKAKGTLGRNLMKAIEHKNHSFQPKTVDVPRFVHAQNNQAQLEKGKDLKSCIDQDN
LDDFLQVVQLQNKNFEALRGMKLKTDMNDREVVIDAIKDQEAINDGAFNIENNQYIQNLR
IPRKPKWTKEMTKDQLNALENQSFVEWRKALAKIEEAHYTIQITPYEKNIEVWKQLWRVI
ERSDIIVQIVDGRDPLFFRCPDVEVYSKEVNADKLNFLLVNKSDLISDDIRKEWSTYLNE
QNVQHMFFSAKMEQEKIDANHAQEVKNNIFLTKDLGLNDDEEEEKKNQDNEKTKQYLNTP
NICNRETLLRTLKELVQSVKQKKNQIKQKKEQESVGNEHLEDQLILDQLDEAENMKFNKQ
KMAIQIGMVGYPNVGKSSVINTLCNKKLVGVGSLPGKTKNFQTHFLEQDLILCDCPGLVF
PNAASTRAEMVCNGVMPIDKLKDYLSPVDLLCSRIPKIVLEKLYKIKIDVEVPDGSYFLS
KYAIAKGYYTGSGVPDMAKSSKLILKELVSGKLLYCKLPPTCEENCGIWQSNQIDIQVGN
ILGDVNEQEQEEKAENMEALMVNQEEKKLDQMLLKQEAQKIGDKIQFDEDDIVFLLAGKK
VNGIKLNKQQKRDIKHAYQRGEAIDMKKYLDQDQILEYGIKNKGMIPPSS


>TTHERM_00440460(gene)
ATGCCGAGAGTTCATAAAGCAAAAGGTACTTTAGGTCGTAACCTAATGAAAGCAATTGAG
CACAAAAACCACTCTTTTTAGCCTAAGACTGTAGATGTTCCTCGTTTTGTTCATGCTCAA
AACAATCAAGCCTAGTTAGAAAAAGGAAAGGACTTAAAATCCTGTATTGACTAAGATAAT
TTGGATGATTTCCTTTAGGTTGTTTAATTACAAAATAAAAACTTTGAAGCCTTGCGTGGT
ATGAAGCTAAAAACTGACATGAATGATAGAGAAGTTGTTATTGATGCTATCAAAGATTAA
GAAGCTATTAATGATGGTGCCTTTAACATTGAAAATAACTAATATATTCAAAATTTACGT
ATTCCAAGAAAGCCTAAGTGGACAAAAGAAATGACTAAAGATTAATTAAATGCTTTAGAA
AATTAATCTTTTGTAGAATGGAGAAAAGCTTTGGCTAAAATTGAAGAAGCTCATTATACA
ATTTAGATTACCCCTTATGAAAAGAACATTGAAGTTTGGAAATAGCTTTGGCGTGTTATT
GAAAGATCAGACATCATTGTATAAATTGTGGATGGCCGTGATCCTCTCTTTTTTAGGTAT
AAATTTGTTTTCTATGCACAAATTTTTGAAAATAAATATTTTATGGAACCCAAAAAAAAC
AATAAATAAATTGATAATAACTTTAATCTCTTAATTCTGTCTGATATTTGATAAAATTAA
TTTACTCAATGGTGGGCTTTAGTTAAATTTAGAGACATATTTATTATCTTTTTAAAATTT
CTATTTTAGATTTTGATAAGAAAAGCCAATAATTAATTAGATTAAAAAATATTATCCACA
ATGTATTTGAGAAGATAAATAGGACAAACACGTTTTTTATCCTTAAGTACATTGGTATAT
CATCAGAGACATATTTATCCATTTATTTATCAGCTTTGAGATAAAATATTTTTAAGCTAA
AAAATGATATAAAATAGAATAGAATAGTTAATTAATTAATTAATCAATTAATTATGTTTG
CTTGCTTTTCTAACAAAAGTATTTTAAGCAAATTATACTTATTGTTCTATTTCAAAAAAA
AATGATAATAAATGAAATAGTAAATAAAATAAAATATATTTTGATACTCTTTCAATCTAT
TCTGCCATTTAAGTTATAGACATTAACTTATCATAATTATTTTCACATCATATAGTAGAA
CCAAAAAATAGAAGGTAGAAATACTTTCATTCAGAATAGAAAGATAAATAAAAGATAGAA
ATTATATCATCTCAATTTCTTGATAAATTAATATACCATTAATCCTCACTAATTAAGGTT
TCCCCTCCCAGATTTTATAATTGGTTGAGGGTCTTAAACTCCAAAAAATCTTAAAAGATG
CCTTAATATAAATAAACCATAATTAATAAGGATTGATGGTATATAATGAACAAATTATGT
TATTGATAAATTCTTTAGAAGCATTAAATTTCTAATAAAAAAATTGATACATTCATTGCT
GGCATGATTTAATTTTATCTATAATAAATTGCTAATTTTCAAATCAATTATAATATTTTA
ATAGACAATTTTAAACCTAATAGAACATTTATTTTCAATCATTACTTTTTTTCTCTTACT
TTTTCATATTTCAAATCTATTTGAATATAAATAAATAGATGTCCTGATGTCGAAGTTTAC
TCTAAAGAAGTCAATGCTGATAAGCTAAATTTCTTGCTTGTTAACAAGTCAGATTTGATA
TCAGATGATATTAGAAAGGAATGGTCTACCTACTTAAATGAATAGAATGTCTAGCACATG
TTCTTTAGCGCTAAGATGGAATAAGAAAAGATTGATGCAAATCATGCTCAAGAAGTCAAA
AATAATATTTTCTTGACTAAGGATTTAGGCTTAAACGATGATGAAGAAGAAGAAAAGAAA
AATCAAGATAACGAAAAAACTAAATAATACTTGAATACTCCAAATATCTGCAACAGAGAA
ACACTGCTTCGCACATTGAAAGAATTAGTTTAATCAGTAAAGCAAAAGAAGAACCAAATC
AAGCAAAAGAAAGAATAAGAATCTGTAGGCAATGAGCATCTTGAAGATCAACTAATTTTA
GATTAGTTAGATGAAGCTGAAAATATGAAATTTAACAAATAAAAAATGGCTATATAAATT
GGTATGGTCGGATATCCTAATGTTGGTAAATCTTCAGTTATTAACACATTGTGTAACAAA
AAACTTGTCGGAGTTGGCTCTCTTCCTGGTAAAACAAAGAATTTCCAAACTCACTTCTTA
GAATAAGATTTGATATTGTGCGATTGCCCTGGTCTCGTTTTCCCCAATGCAGCTTCTACT
CGTGCTGAAATGGTTTGCAACGGTGTCATGCCTATTGATAAACTTAAAGACTATCTCAGT
CCTGTTGATTTACTCTGCTCTCGTATTCCTAAAATAGTTCTTGAAAAGTTATATAAAATA
AAAATTGATGTTGAAGTTCCTGATGGTTCTTACTTCCTTTCTAAATATGCAATTGCTAAG
GGTTACTACACTGGCAGTGGTGTTCCTGATATGGCTAAGTCATCTAAACTTATATTAAAG
GAACTTGTTTCTGGAAAGCTTCTTTACTGTAAATTGCCTCCTACCTGTGAAGAAAACTGC
GGTATCTGGCAAAGTAACTAAATTGACATATAAGTAGGAAATATTTTAGGAGATGTCAAT
GAGTAGGAATAAGAAGAAAAAGCTGAAAATATGGAAGCATTAATGGTCAACTAAGAAGAA
AAAAAACTTGATTAAATGCTTTTGAAATAAGAAGCTTAGAAAATAGGTGATAAAATCTAG
TTTGATGAAGATGACATAGTCTTCTTATTAGCAGGCAAAAAAGTAAATGGAATTAAGCTA
AATAAGTAGTAAAAAAGAGATATCAAGCACGCATATTAAAGAGGTGAAGCTATTGATATG
AAAAAATACCTAGACCAAGACCAAATATTAGAATATGGAATCAAAAATAAAGGTATGATC
CCTCCTTCATCCTGA