Identifiers and Description

Gene Model Identifier

TTHERM_00439300

Standard Name

None

Aliases

PreTt05487 | 49.m00259 | 3708.m00108

Description

TFIIS helical bundle-like domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05909 ) IWS1 C-terminus
  • ( PF08945 ) Bcl-x interacting
  • ( TIGR00162 ) conserved hypothetical protein TIGR00162
  • ( TIGR00075 ) hydrogenase expression/formation protein HypD
  • ( PF08711 ) Transcription elongation factor S-II protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00439300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12394.12.9991172563576427e-86hypothetical protein (243 aa)
OxytrichaContig8878.0.0.g562.0004286606204839e-16TFIIS helical bundle-like doma
in
DictyBaseDDB_G02743270.000000000040005666873964816DDB_G0274327 on chromosome: 2
position 3920096 to 3922148
SGDYPR133C0.0000000008996637801615584SPN1 Protein involved in RNA p
olymerase II transcription; in
teracts genetically or physica
lly with RNAP II, TBP, TFIIS,
and chromatin remodelling fact
ors; central domain highly con
served throughout eukaryotes;
mutations confer an Spt- pheno
type
WormBaseWBGene000087290.0000000010002658722841845IWS1-like protein status:Con
firmed UniProt:Q19375 prot
ein_id:CAA94590.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00439300(coding)
ATGTCAGACGAAGAAAAACTAGATATATTTGATGATAATGAAGGTGAATAACCAGTAGAT
GCTGTAAACGATTAAGCTTTTGATGACTAGCAAGTAGATGAGTTGTTGGATTTAAATTTA
GATGATGCTGAGTTTGATGATCTTGAATTAGAAAAATATGTAGAAGGAAATGATGATAAA
CCAAGTAAAAGGATTTAAAAAAAAAGAAAGTCTTCTTCTGGTGGAAATAATGTAGAAGCT
AAGTAATAAAAACCAAGATCCAGTAAGAAAGAGGAAGAAAGATTAAAAAATGAGCTCGAA
ATCAAAGAAGAAGTAAAAAAAATAAAAAGTGAGATGAAATAGATTCATTAAAGAGATATA
AAAGCTGTAGAAAATAAAAAACCTGCACTCAATAAAATAAAGCACATTGATGAAATAATT
TCTAAGCTTAGCAAGTTAGGCGTCTAGAGAGAATTTGTGTAAGATAAAGGAATTGATTAT
TTAGCTGACTGGCTTGATAAAATTCCAAATGGACCAGAACCAAGTGTCACTTTAAGAAAG
AAACTACTTTAATTCATTTTTGAATTAAATGTTACTCGCTCAAATTTGACTGGAATTCGT
CTCGGAAAAGTTATCTATAAGATCTCGTCAAAGAGTGAAGTAAAAGAGTTGAGAATATTA
GCTAACAAAGTTGTGGAAAAATGGAGTAAAATAATAAATAGCAGAGATAAAAAATATGAT
GATGAGGATCAGTACGAATACGGAGATTGA


>TTHERM_00439300(protein)
MSDEEKLDIFDDNEGEQPVDAVNDQAFDDQQVDELLDLNLDDAEFDDLELEKYVEGNDDK
PSKRIQKKRKSSSGGNNVEAKQQKPRSSKKEEERLKNELEIKEEVKKIKSEMKQIHQRDI
KAVENKKPALNKIKHIDEIISKLSKLGVQREFVQDKGIDYLADWLDKIPNGPEPSVTLRK
KLLQFIFELNVTRSNLTGIRLGKVIYKISSKSEVKELRILANKVVEKWSKIINSRDKKYD
DEDQYEYGD


>TTHERM_00439300(gene)
ATGTCAGACGAAGAAAAACTAGATATATTTGATGATAATGAAGGTGAATAACCAGTAGAT
GCTGTAAACGATTAAGCTTTTGATGACTAGCAAGTAGATGAGTTGTTGGATTTAAATTTA
GATGATGCTGAGTTTGATGATCTTGAATTAGAAAAATATGTAGAAGGAAATGATGATAAA
CCAAGTAAAAGGATTTAAAAAAAAAGAAAGTCTTCTTCTGGTGGAAATAATGTAGAAGCT
AAGTAATAAAAACCAAGATCCAGTAAGAAAGAGGAAGAAAGATTAAAAAATGAGCTCGAA
ATCAAAGAAGAAGTAAAAAAAATAAAAAGTGAGATGAAATAGATTCATTAAAGAGATATA
AAAGCTGTAGAAAATAAAAAACCTGCACTCAATAAAATAAAGCACATTGATGAAATAATT
TCTAAGCTTAGCAAGGTAAATAAATAAATTATTTATTTATTTATCCAATAGAATTAGGTC
TGTCTGCAATTTCATAAAAATATTTTTTTGGAAAGAGTGAAAAATTTTGTAAAAAATCAA
TAAATCAGAGTCAGACTTAAAAATAGTTTAATAAATCAAATTATCAAAGAAATTTTGATT
GAACATAGAATATATTTATTTAAGATAGAGGAAAAATAAGTGAGTGAGGATTCAAATTTT
TTTTTGCTCCATATGAATTATTTTTATTTTATATACTCAGTTTAAAACAAAAAGAATTGC
TTTCTATTTAAAGACACACTTAATTGAACTTACTTATTAATTATTTACTAATTTTTATAT
AGTTAGGCGTCTAGAGAGAATTTGTGTAAGATAAAGGAATTGATTATTTAGCTGACTGGC
TTGATAAAATTCCAAATGGACCAGAACCAAGTGTCACTTTAAGAAAGAAACTACTTTAAT
TCATTTTTGAATTAAATGTTACTCGCTCAAATTTGACTGGAATTCGTCTCGGAAAAGTTA
TCTATAAGATCTCGTCAAAGAGTAGATTAAACTTGAAATATAAATAAATTTAACTTATTA
AAATTCATAATTAAACAAAAGGTGAAGTAAAAGAGTTGAGAATATTAGCTAACAAAGTTG
TGGAAAAATGGAGTAAAATAATAAATAGCAGAGTAAAAATTTAATTACTTTTTAAACTGA
ATTCTGAATTAAAATTTTAAATTAAACAAGGATAAAAAATATGATGATGAGGATCAGTAC
GAATACGGAGATTGA