Identifiers and Description

Gene Model Identifier

TTHERM_00420910

Standard Name

None

Aliases

PreTt07216 | 46.m00271 | 3679.m00121

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00420910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10986.19.997093137033517e-262hypothetical protein (1064 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420910(coding)
ATGTAGTCATCTTCCAAATCTCAGCTAGGTAGCAGCGATATGAAGTTTAATGTCCCTAAC
TCCCCATAAATAAATTTACCTTTGTCCATTTCAGAATTTTAAAACTCTATCCAGCAAAAA
TAAAAAAAGGAATAGATAAATTCAGTTTAAAACACTGCTATGGGTAATATTCATTACAAT
TCATGTTCCTTACCATTGTAAATGTAAAGTATTTTTACTTAAGAATACAAAGAAGAGCTA
TGCTAGCTATAATAGGATAATTCACTACCAAAATCGTAGGTTTTAGAATAATAAAATAGC
CTGAACTGCAAAATTTTAGATAATGATGAGACAAGCACTAAATCATAAAACCTAGAGCAA
TCTTTAAGAGAATAGGTATTTTAAAATAGCTTATTATAAGGTAGCAGACAAATGAAAAGA
TTAGCCAGTACATAAAATAGTAATGATGGAGGTTATCATGGAAATATTCTCTAAATTGGA
GTTTCTTTTTCTCCCTTATCTTCTACCCATAACTCTCAAAATTCTACTATTTAAGTAAAC
AATTTGCTAGCAAGCAGCGGTAATTCAAATAAAACTATTAAAACCATAAATAGTAATCCA
TAAATTTAAAATTCTCCTAATACCAACCCATTAAATTTAAATTCTCTTAACAACGGAACT
GATATGCCTTTATTAATGAAATCTCCCTCTAATTTGCATTAAAGCAAAGAAAAATAAAGC
TCTACTTAAAAAAATCTAATTAAGGAATAGAATGATAGTAATAAGTATCTTAAGCTAAAA
AGAAATTCTTCTTATGGAAGTTTTTCAAATATTTAAAATTCTTCTCTAAGTATAGCTTAA
AAAAGAAATGCATTTGAATTAGGAAAAAATAATAGGAGTAGAAATTTATAAATGACAGAT
CTAAGTGTTTAAAATGAAGGGTCTACTTTTTTGAATAACTCATTATGTAATAAGTAAATT
AAAAATTCCTCTTAATCAAGCACTTCAATAAATAATACAAATTAATAAAATTCAACATAG
CCATAAACTTCTACATAATAAAATAACCAAGATTTTAATTAATTACTTTTGGAAATATCT
TGCTAAAATTCTTTGCACCTGTATAATAACAATTATCTAAATACTCAGATAAATAATTTA
AACTAAAATTAAACACCTTCAAATTAGAATGCAAAATATTATATGAGCAATAATAATAAT
AATAATAATAACTACATAGTTTCTTCTAATTTAAATTTACCTAAATAGTAATCTGCTACC
TAATTTGAAACAAATTAGAACAAATAATATCTTGAAAATAACTAAAGCTCTTATTTCAAC
TAACTATCCACAAATTCAGGAGATAAAAATAAAAATTAATTTATTGATCAAATAAATAGT
AATAATAGTTGCTTCAAACCAAGTAATCTTTCTTTTACAGAGCAATCTAAGTAAATATAA
GATTTTTAATACAAATAAGATTCTTGCAATTAAAATATTAATCAAACCTCGTTAAATTCA
AGTAATAATAAAACTTTTAATTAAAATTTTAACTAATCAGCAGCTACCTTTTAAGATTCA
GCTTCAGACTAAAAACTTAATAATAATTAATTACCAAATAGTTAAATTACTCCTTTTATC
TTCAATAAGCCTTTATACTTAGAAAATAAATAATTTTTATAAAATTCAGCCAATCAAATA
ATTCAGGACAATCAAAATTAAAATACAGAAAATAGGAAAATTTAAATGTGCAAGAATCAC
AGACATCAAAGTGCTAATCATTATGCGTTAGATGAAGATAGGAATCAATAATTTTACTGT
TACACATGCGCAGTATTACTATATTCATAGGGACACTAGATATTTTCAATAGAAGAATCC
CTAGAATTAAATGCTATGAAAATGATAGTAGAGAATAAGAGAATGAAAGAAATATAAAAT
AAAAAGGAAGCAGTTGATAAAATACTTTTTGCAGTTAAAGATCTCATTCCTTAAATAACA
AATTCAATTTGTTCTATGGATCGAAAAGAAGGAGATATTTATAAGTTTTTGGAGACTCAA
GAAAGAAATTTAGATTCTTAATTCAACAAGTTAATATTTGAATTAAATTAAAACAGAAAA
TAAAAATTAGATTAGCTACTTCAATGTAAATAGCAAATCAAAAAGTAATATCTACAGGTC
AATTAAGTTTGCTAAAACAATTTACAGTAACTAATTAAAGTGCAAGAAGATATATTAGAT
AATTACAATAATATAATTTTATAATTTGAAGAGAATAAAGTAGCTTCTATCATTTAAAAC
TATTTTTCAATTTGGAATTAAGCTAACTTGCATCACGAGAGCATTTCTAATAATGACCAA
CTATTTGTTTACAAATCAGACTAAAATTAATTTAAGTAAATTAACGATTAAATTAATTTT
TTATGTAGCAACACATTAAAATAGATTATGACGACATTTATTAAAAAAAATAATGATAAT
AATTAAATGAATTTATCAATATTAAGTTGTTCACCCAATAAATTATACTAACCCAATTAT
TAATTTACTCGCTCAAAATCTTCATAGATTTTACCAATATCTACTGATGATAGCTATAAT
TCGATGAGAAATTAACAGATAGCATCTTCAAGCACTAGATAAAACTCTTAAAAGTAAATT
TATAAAAATGAAAGCTAGAATAATGATAAATCTTAAAATTTAACTCAAAAAATAAACAAA
AATCATACAAATGGTTACAAATTACAAGCATAAAAATAATAGGTAAATTAAAACTAATGC
ACTAATTATTAAAGAAAAATAAAATCCCTCTAACATTCAATGGCTTTAAATAATAAATAA
GTTTATATCTCATTTGATAATAAAGATGCATTTAAAAATCATTTAGATGCAGAAAATAAA
GAAAATGTCAATACAGTAAATGGAGTCTAGACTAAATTTGATAATAGCTTACTAAAAGTC
TAGTCTGCACATCATTCTAAAGCTTAAAGCCAACCATAACTGATTTACATTGACTTAAAA
GATATTTAAAAAATGCCATCAATATCAACTCCATAAAATAATAACTATAATAGCAACATT
CAAATAGACTAAAATTTGTTTTTAAATACCTAATAGTAAAATGATGTTATTTTAACATTA
GATGATTGTACTACCTTCAGAAAAAAAGATACAATTTAAGAAATAGAAAATGAAACTCAA
ATAGGAGATTACCTATAAAACCTTATTAATAAAGCTAATTTAGAAAAATAAAAGTTAAAT
AATAATATATCAGAACAAAATTAAAATAAATTAATTAACACTTAAATAAATAAATAAGAA
TAAAATTGTTATCAACCAAAATTAGCTTAAAATTATAATAATAATTAACTCTACTAGAAT
TTAGATATCTATGGAAGCTTGGAAAGATAAAATTAGGATAAATTCTATATTGATGGAGAA
TTAGAATAAAAAGCACAAGGATAAACTCCAAACTTTTCTAACAAAAATAAATTAAATAAT
TAATCACCAAGCAACAGGAATCTAGAAAATGTACAAAATCAAGAAAACAATAATAATGTC
CTGAAAGAATTTAGCTATTTAAATGATGGTTGTAAAGAATTAGATGACATAATAGAAAAA
GAACAAAGATCAAGAGACAGCTCAATAAATAAAAAGAAACACTTCAATGAAATGATCAAA
GCAGTTTAACATAATTAAATTCAAAGAAACTTAAATTGCGAAAATATATTAAGGAAAGTT
TCAGATAATTAATTAGACCTTTCTTCCATTTCATGTTCATCTACTCCATAACATTTTAGA
TCTAATAGTGGATAAACATCAAATTTATCATGTAAAAATTCTTTAGTTTCCTCAAAAAAT
AGGTACTTTTTGAGAAGCGATGAACATATAACCTCTGAAAAGTATAATTAAGCAATAAAG
AAATCCCCAATAGAAGAAATGTTATCATCTAATAAATTTGCAAAAATTGAAGATGTTGCA
AAAATAGTCTAAAAACTATCATTTGAAAAGGGTCAATAAATTTAGGATTAACTGAATATG
GAGTCTATTGTTGAAGAAGATAGTCGCATAAGTCAAACAATAGTAAAGTCCGGAGTAGAT
AACAATTATGAGAATATTTTACTTTTAAAAGAATTATAGGAAAATATATAAAGAGAAAAA
TACAATAATAAAAATTTAATGAGTGACGAAAATTTTATTCATAGATTAAATAACATTAAT
TTGGTAGAAGAAAATGATAATATAATTATTTCATAACAGTGA


>TTHERM_00420910(protein)
MQSSSKSQLGSSDMKFNVPNSPQINLPLSISEFQNSIQQKQKKEQINSVQNTAMGNIHYN
SCSLPLQMQSIFTQEYKEELCQLQQDNSLPKSQVLEQQNSLNCKILDNDETSTKSQNLEQ
SLREQVFQNSLLQGSRQMKRLASTQNSNDGGYHGNILQIGVSFSPLSSTHNSQNSTIQVN
NLLASSGNSNKTIKTINSNPQIQNSPNTNPLNLNSLNNGTDMPLLMKSPSNLHQSKEKQS
STQKNLIKEQNDSNKYLKLKRNSSYGSFSNIQNSSLSIAQKRNAFELGKNNRSRNLQMTD
LSVQNEGSTFLNNSLCNKQIKNSSQSSTSINNTNQQNSTQPQTSTQQNNQDFNQLLLEIS
CQNSLHLYNNNYLNTQINNLNQNQTPSNQNAKYYMSNNNNNNNNYIVSSNLNLPKQQSAT
QFETNQNKQYLENNQSSYFNQLSTNSGDKNKNQFIDQINSNNSCFKPSNLSFTEQSKQIQ
DFQYKQDSCNQNINQTSLNSSNNKTFNQNFNQSAATFQDSASDQKLNNNQLPNSQITPFI
FNKPLYLENKQFLQNSANQIIQDNQNQNTENRKIQMCKNHRHQSANHYALDEDRNQQFYC
YTCAVLLYSQGHQIFSIEESLELNAMKMIVENKRMKEIQNKKEAVDKILFAVKDLIPQIT
NSICSMDRKEGDIYKFLETQERNLDSQFNKLIFELNQNRKQKLDQLLQCKQQIKKQYLQV
NQVCQNNLQQLIKVQEDILDNYNNIILQFEENKVASIIQNYFSIWNQANLHHESISNNDQ
LFVYKSDQNQFKQINDQINFLCSNTLKQIMTTFIKKNNDNNQMNLSILSCSPNKLYQPNY
QFTRSKSSQILPISTDDSYNSMRNQQIASSSTRQNSQKQIYKNESQNNDKSQNLTQKINK
NHTNGYKLQAQKQQVNQNQCTNYQRKIKSLQHSMALNNKQVYISFDNKDAFKNHLDAENK
ENVNTVNGVQTKFDNSLLKVQSAHHSKAQSQPQLIYIDLKDIQKMPSISTPQNNNYNSNI
QIDQNLFLNTQQQNDVILTLDDCTTFRKKDTIQEIENETQIGDYLQNLINKANLEKQKLN
NNISEQNQNKLINTQINKQEQNCYQPKLAQNYNNNQLYQNLDIYGSLERQNQDKFYIDGE
LEQKAQGQTPNFSNKNKLNNQSPSNRNLENVQNQENNNNVLKEFSYLNDGCKELDDIIEK
EQRSRDSSINKKKHFNEMIKAVQHNQIQRNLNCENILRKVSDNQLDLSSISCSSTPQHFR
SNSGQTSNLSCKNSLVSSKNRYFLRSDEHITSEKYNQAIKKSPIEEMLSSNKFAKIEDVA
KIVQKLSFEKGQQIQDQLNMESIVEEDSRISQTIVKSGVDNNYENILLLKELQENIQREK
YNNKNLMSDENFIHRLNNINLVEENDNIIISQQ


>TTHERM_00420910(gene)
ATGTAGTCATCTTCCAAATCTCAGCTAGGTAGCAGCGATATGAAGTTTAATGTCCCTAAC
TCCCCATAAATAAATTTACCTTTGTCCATTTCAGAATTTTAAAACTCTATCCAGCAAAAA
TAAAAAAAGGAATAGATAAATTCAGTTTAAAACACTGCTATGGGTAATATTCATTACAAT
TCATGTTCCTTACCATTGTAAATGTAAAGTATTTTTACTTAAGAATACAAAGAAGAGCTA
TGCTAGCTATAATAGGATAATTCACTACCAAAATCGTAGGTTTTAGAATAATAAAATAGC
CTGAACTGCAAAATTTTAGATAATGATGAGACAAGCACTAAATCATAAAACCTAGAGCAA
TCTTTAAGAGAATAGGTATTTTAAAATAGCTTATTATAAGGTAGCAGACAAATGAAAAGA
TTAGCCAGTACATAAAATAGTAATGATGGAGGTTATCATGGAAATATTCTCTAAATTGGA
GTTTCTTTTTCTCCCTTATCTTCTACCCATAACTCTCAAAATTCTACTATTTAAGTAAAC
AATTTGCTAGCAAGCAGCGGTAATTCAAATAAAACTATTAAAACCATAAATAGTAATCCA
TAAATTTAAAATTCTCCTAATACCAACCCATTAAATTTAAATTCTCTTAACAACGGAACT
GATATGCCTTTATTAATGAAATCTCCCTCTAATTTGCATTAAAGCAAAGAAAAATAAAGC
TCTACTTAAAAAAATCTAATTAAGGAATAGAATGATAGTAATAAGTATCTTAAGCTAAAA
AGAAATTCTTCTTATGGAAGTTTTTCAAATATTTAAAATTCTTCTCTAAGTATAGCTTAA
AAAAGAAATGCATTTGAATTAGGAAAAAATAATAGGAGTAGAAATTTATAAATGACAGAT
CTAAGTGTTTAAAATGAAGGGTCTACTTTTTTGAATAACTCATTATGTAATAAGTAAATT
AAAAATTCCTCTTAATCAAGCACTTCAATAAATAATACAAATTAATAAAATTCAACATAG
CCATAAACTTCTACATAATAAAATAACCAAGATTTTAATTAATTACTTTTGGAAATATCT
TGCTAAAATTCTTTGCACCTGTATAATAACAATTATCTAAATACTCAGATAAATAATTTA
AACTAAAATTAAACACCTTCAAATTAGAATGCAAAATATTATATGAGCAATAATAATAAT
AATAATAATAACTACATAGTTTCTTCTAATTTAAATTTACCTAAATAGTAATCTGCTACC
TAATTTGAAACAAATTAGAACAAATAATATCTTGAAAATAACTAAAGCTCTTATTTCAAC
TAACTATCCACAAATTCAGGAGATAAAAATAAAAATTAATTTATTGATCAAATAAATAGT
AATAATAGTTGCTTCAAACCAAGTAATCTTTCTTTTACAGAGCAATCTAAGTAAATATAA
GATTTTTAATACAAATAAGATTCTTGCAATTAAAATATTAATCAAACCTCGTTAAATTCA
AGTAATAATAAAACTTTTAATTAAAATTTTAACTAATCAGCAGCTACCTTTTAAGATTCA
GCTTCAGACTAAAAACTTAATAATAATTAATTACCAAATAGTTAAATTACTCCTTTTATC
TTCAATAAGCCTTTATACTTAGAAAATAAATAATTTTTATAAAATTCAGCCAATCAAATA
ATTCAGGACAATCAAAATTAAAATACAGAAAATAGGAAAATTTAAATGTGCAAGAATCAC
AGACATCAAAGTGTAATTTTTAAAAAATTAATTTTAATTTTGCAATAAAATAAAACAATA
GAAATTTATTTTAGAAAAAGAATTATTTTTATAATTTTGAAATTTATTTATATTTTTTAA
AAATTATCTGCTATCTAATAATAGGCTAATCATTATGCGTTAGATGAAGATAGGAATCAA
TAATTTTACTGTTACACATGCGCAGTATTACTATATTCATAGGGACACTAGATATTTTCA
ATAGAAGAATCCCTAGAATTAAATGCTATGAAAATGATAGTAGAGAATAAGAGAATGAAA
GAAATATAAAATAAAAAGGAAGCAGTTGATAAAATACTTTTTGCAGTTAAAGATCTCATT
CCTTAAATAACAAATTCAATTTGTTCTATGGATCGAAAAGAAGGAGATATTTATAAGTTT
TTGGAGACTCAAGAAAGAAATTTAGATTCTTAATTCAACAAGTTAATATTTGAATTAAAT
TAAAACAGAAAATAAAAATTAGATTAGCTACTTCAATGTAAATAGCAAATCAAAAAGTAA
TATCTACAGGTCAATTAAGTTTGCTAAAACAATTTACAGTAACTAATTAAAGTGCAAGAA
GATATATTAGATAATTACAATAATATAATTTTATAATTTGAAGAGAATAAAGTAGCTTCT
ATCATTTAAAACTATTTTTCAATTTGGAATTAAGCTAACTTGCATCACGAGAGCATTTCT
AATAATGACCAACTATTTGTTTACAAATCAGACTAAAATTAATTTAAGTAAATTAACGAT
TAAATTAATTTTTTATGTAGCAACACATTAAAATAGATTATGACGACATTTATTAAAAAA
AATAATGATAATAATTAAATGAATTTATCAATATTAAGTTGTTCACCCAATAAATTATAC
TAACCCAATTATTAATTTACTCGCTCAAAATCTTCATAGATTTTACCAATATCTACTGAT
GATAGCTATAATTCGATGAGAAATTAACAGATAGCATCTTCAAGCACTAGATAAAACTCT
TAAAAGTAAATTTATAAAAATGAAAGCTAGAATAATGATAAATCTTAAAATTTAACTCAA
AAAATAAACAAAAATCATACAAATGGTTACAAATTACAAGCATAAAAATAATAGGTAAAT
TAAAACTAATGCACTAATTATTAAAGAAAAATAAAATCCCTCTAACATTCAATGGCTTTA
AATAATAAATAAGTTTATATCTCATTTGATAATAAAGATGCATTTAAAAATCATTTAGAT
GCAGAAAATAAAGAAAATGTCAATACAGTAAATGGAGTCTAGACTAAATTTGATAATAGC
TTACTAAAAGTCTAGTCTGCACATCATTCTAAAGCTTAAAGCCAACCATAACTGATTTAC
ATTGACTTAAAAGATATTTAAAAAATGCCATCAATATCAACTCCATAAAATAATAACTAT
AATAGCAACATTCAAATAGACTAAAATTTGTTTTTAAATACCTAATAGTAAAATGATGTT
ATTTTAACATTAGATGATTGTACTACCTTCAGAAAAAAAGATACAATTTAAGAAATAGAA
AATGAAACTCAAATAGGAGATTACCTATAAAACCTTATTAATAAAGCTAATTTAGAAAAA
TAAAAGTTAAATAATAATATATCAGAACAAAATTAAAATAAATTAATTAACACTTAAATA
AATAAATAAGAATAAAATTGTTATCAACCAAAATTAGCTTAAAATTATAATAATAATTAA
CTCTACTAGAATTTAGATATCTATGGAAGCTTGGAAAGATAAAATTAGGATAAATTCTAT
ATTGATGGAGAATTAGAATAAAAAGCACAAGGATAAACTCCAAACTTTTCTAACAAAAAT
AAATTAAATAATTAATCACCAAGCAACAGGAATCTAGAAAATGTACAAAATCAAGAAAAC
AATAATAATGTCCTGAAAGAATTTAGCTATTTAAATGATGGTTGTAAAGAATTAGATGAC
ATAATAGAAAAAGAACAAAGATCAAGAGACAGCTCAATAAATAAAAAGAAACACTTCAAT
GAAATGATCAAAGCAGTTTAACATAATTAAATTCAAAGAAACTTAAATTGCGAAAATATA
TTAAGGAAAGTTTCAGATAATTAATTAGACCTTTCTTCCATTTCATGTTCATCTACTCCA
TAACATTTTAGATCTAATAGTGGATAAACATCAAATTTATCATGTAAAAATTCTTTAGTT
TCCTCAAAAAATAGGTACTTTTTGAGAAGCGATGAACATATAACCTCTGAAAAGTATAAT
TAAGCAATAAAGAAATCCCCAATAGAAGAAATGTTATCATCTAATAAATTTGCAAAAATT
GAAGATGTTGCAAAAATAGTCTAAAAACTATCATTTGAAAAGGGTCAATAAATTTAGGAT
TAACTGAATATGGAGTCTATTGTTGAAGAAGATAGTCGCATAAGTCAAACAATAGTAAAG
TCCGGAGTAGATAACAATTATGAGAATATTTTACTTTTAAAAGAATTATAGGAAAATATA
TAAAGAGAAAAATACAATAATAAAAATTTAATGAGTGACGAAAATTTTATTCATAGATTA
AATAACATTAATTTGGTAGAAGAAAATGATAATATAATTATTTCATAACAGTGA