Identifiers and Description

Gene Model Identifier

TTHERM_00420400

Standard Name

AAP8 (Ada2-associated protein 8 )

Aliases

PreTt07165 | 46.m00220 | 3679.m00070 | A2A8

Description

Member of the SAGA complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02170 ) PAZ domain
  • ( PF08621 ) RPAP1-like, N-terminal
  • ( TIGR02846 ) RNA polymerase sigma-K factor
  • ( PF04508 ) Viral A-type inclusion protein repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00420400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11032.19.997093137033517e-262hypothetical protein (2320 aa)
OxytrichaContig442.1.g27.998167219297731e-26Zinc-finger domain of monoamin
e-oxidase A repressor R1

General Information

Paragraph NoGene NameParagraph Text
127AAP8,
COI14
Former TTHERM_00420400 contained TTHERM_00420400, TTHERM_000420399, and TTHERM_000420398. Woehrer et al (2015) called the former TTHERM_00420400 as COI14. The primers used for their gene expression analysis by RT-PCR are complementary to TTHERM_000420399. Therefore, TTHERM_000420399 takes over the name COI14. According to Saettone et al. (2018), the new TTHERM_00420400 is similar to Ada2-associated protein and thus now called AAP8.

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  3. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00420400(coding)
ATGGGTCGTTTAAAGCAGAAATTACTAGAAAAAAGATTGCTCCAATAGTAATAAAAAAAA
AAGAATCATATTAAAAAAGAGAAAGGAGAAATTACAAAATTACAAAATGTGAAGGAAACA
AATGCAGAATAATAGAAAAAAAAGGATCAAAAAGGAAAGGATGATGATGATTCTCGTAAT
GCACTCGAAAAAATAATTAAACTTGATAAAAAAAATAGTAACTTTGATTTATATGATCCA
CTTACAAACAATTTTCTGAAAGTTCGAAGTGTTAATTACTAGATAAATTATTAGTAAATA
CAAGGATTGTCTTAAACAGATCATTAAATGAGATAATTTTGGAGACATGTCAATAGCACA
TATTTAAGGAGAGTGCAAAGTTAGGATGAAAATAAGCTTGAGTATTTAAAAAATTTATTC
AATACTCCTATTGAGCCTGACAATTAGGAGTTAGAATGGGACGATTGGAGAGCTTAGCTA
GCTGTTTAATATATCTTAGATGAATCTGTCCAAAGGTAGTATTAAGATGATGACTTATCT
AATCTAAACTATGAAAATCTGCTACTTCATATGAGAATTACTTTTCTTATTGCTAATCAA
TATATTAAGGATAAATCTCTCATATAAAAAATATTGCAAACCAAAAAGAAATAAATTCCT
AAAAATTCATCTAGTTATTAAAGCTAACTTGAAGCATTTCAAAATGAAAAAAACTAATTG
CTATAGATTATCTAGAATATTGCTTAAAACTCATAATTATACAAAGAAATACAAGAAGAA
GAAGATCAACTGTTGGAGGAAACTGTAAAATTAAAAGAAGAATTAAAATAAATAAATCAA
CAAAATCATAAGAATATTTAAAGATTAGAGCAGCAACTTAAAATGGAATTTTGTAAGTAG
CAAATGATATATTTGGAAACAGATTATATTCTTTCAAAGTCTAAAAATGAAAATATTCAC
ATACAAAAAGATTATAATGAGGAACAAAAGCACCTTTTGCTTGAGAAACACTTTGCTAAA
ATGGAGAATATGAATTTGTAGGCTTCATTTTTACATTAAACTATTTTAAGATTGGAGAAG
AAATAGCTTTCGGAAACTATTTCATGCATTACTGGATACACAAACAAATACAATTAGCCA
TAATTTGAATTAAGGTTTGAGTCAGCTTATAATGATTCAGCAGAATGGATAAGTGAGTAG
TTATTAGATGAGTTGAACTCTTTAAGAGATTAAAATTTATTTTCTTTTTATAACATTCCT
TAAAAAACGCTGTATTCTCATATAGCAAACAACTTTTTAGGATGGAATTATATATAAAAA
AACAGAGATAAGCCAAACTAATTGAAGCTAAAAAATATTAAGGATTTGATAACTTAAAAA
GAATAACCTGGAAATAAAATGAATTAGTATGAAATATGTCATCACTGTAAACATTTGTTT
AAAAAGAGTATTCTTTTTTAATGCAAGTATAAAGCATCTACTATGGGAATACCTGTCCAT
AATTATATTGTTACTGATCCCTTCTTATTTTAATTTATTGAATCTGACAATACAAACAGT
AAGAAGCCTCAAGTCAACAAAAAAAGAAACTGCTATACTATGTTCTAAAAAGTAGATGGA
GATTTGGTTTGCAAAAGAATGTACTGTAGATCTTGTCTAAAATAAAATTACGATTTAATT
CTTTCAGAAATTAAAGATAAGTAAGATTGGCTTTGCCCTTTCTGCTAAGGAAATTGTTAT
TGTACTAGATGTCTTCGAAATGAATTACTCATGAAATACAAAGGAATTTATATTTTATTA
GGAGGAGATATTAATTTAATTCAAAGAGAATCTGTGTTTGAATATTATTCTCAGCAGATG
TCCTAGCAAAGATAAAGAGAATATTAAGAGTAGCAATTAAACATGAATAGCAGAGGTATA
AAAAATTCAGTAAAAGGATTAAAATTAAAAGATGAACACACATAAAAAATAGTTGAAGTT
GAGAGATTAAAGTAATTATGTCAATAAGTGAATAAAAGAGAAAAATATAAATTTGAAATG
CTGAAATAGAATATAGATATATTTAGAGAAAAGTATAAAACTCACACTGATAAAGAATTC
CCCATAGTTGACATAAATAATTTGAATACACAAGAATTTATTGCAGACTTATTACCTTTC
CAAAATGAACTAGTTATAAATACAATAAATAACTTTCAAAAAAACAACTAAATAATAGGC
AAAAACTTAACAAAAAATAGCAGTAATAAAATAAAAATGATTCAAATTAACAAACTTTTC
AAAAAGAAAAATAAAAAATAAAAAAATGATGATGATGATGAAGAAAATAATATTCAATAG
GAAAATTCAGTTAAGAGTTACACTTCTTAAAACTCTTCATCAAATTCATAATCTTAGTCA
CAATCATCCATAAATTCAAAAGGAGATGAAAGAATAGCTAGTGGTGTGTAAAGAAAGAAA
GCTTAATCATTAAAAATAAATAAGTTAATTAAAAAAACAAAAACAAGTAGTAAAGTCATG
CTTAAAAAGAGCAATAAGAAGGGTAATTAGAGGGACTGA


>TTHERM_00420400(protein)
MGRLKQKLLEKRLLQQQQKKKNHIKKEKGEITKLQNVKETNAEQQKKKDQKGKDDDDSRN
ALEKIIKLDKKNSNFDLYDPLTNNFLKVRSVNYQINYQQIQGLSQTDHQMRQFWRHVNST
YLRRVQSQDENKLEYLKNLFNTPIEPDNQELEWDDWRAQLAVQYILDESVQRQYQDDDLS
NLNYENLLLHMRITFLIANQYIKDKSLIQKILQTKKKQIPKNSSSYQSQLEAFQNEKNQL
LQIIQNIAQNSQLYKEIQEEEDQLLEETVKLKEELKQINQQNHKNIQRLEQQLKMEFCKQ
QMIYLETDYILSKSKNENIHIQKDYNEEQKHLLLEKHFAKMENMNLQASFLHQTILRLEK
KQLSETISCITGYTNKYNQPQFELRFESAYNDSAEWISEQLLDELNSLRDQNLFSFYNIP
QKTLYSHIANNFLGWNYIQKNRDKPNQLKLKNIKDLITQKEQPGNKMNQYEICHHCKHLF
KKSILFQCKYKASTMGIPVHNYIVTDPFLFQFIESDNTNSKKPQVNKKRNCYTMFQKVDG
DLVCKRMYCRSCLKQNYDLILSEIKDKQDWLCPFCQGNCYCTRCLRNELLMKYKGIYILL
GGDINLIQRESVFEYYSQQMSQQRQREYQEQQLNMNSRGIKNSVKGLKLKDEHTQKIVEV
ERLKQLCQQVNKREKYKFEMLKQNIDIFREKYKTHTDKEFPIVDINNLNTQEFIADLLPF
QNELVINTINNFQKNNQIIGKNLTKNSSNKIKMIQINKLFKKKNKKQKNDDDDEENNIQQ
ENSVKSYTSQNSSSNSQSQSQSSINSKGDERIASGVQRKKAQSLKINKLIKKTKTSSKVM
LKKSNKKGNQRD


>TTHERM_00420400(gene)
ATGGGTCGTTTAAAGCAGAAATTACTAGAAAAAAGATTGCTCCAATAGTAATAAAAAAAA
AAGAATCATATTAAAAAAGAGAAAGGAGAAATTACAAAATTACAAAATGTGAAGGAAACA
AATGCAGAATAATAGAAAAAAAAGGATCAAAAAGGAAAGGATGATGATGATTCTCGTAAT
GCACTCGAAAAAATAATTAAACTTGATAAAAAAAATAGTAACTTTGATTTATATGATCCA
CTTACAAAGTATTAGAGTTTATTTTAAGCATTATTAAGATATTAAAAATCAAAAAAATGG
AAAATGGGAAAAATTATTTTGTTAACTTTTATTTTTGGAATTAATAGCAATTTTCTGAAA
GTTCGAAGTGTTAATTACTAGATAAATTATTAGTAAATACAAGGATTGTCTTAAACAGAT
CATTAAATGAGATAATTTTGGAGACATGTCAATAGCACATATTTAAGGAGAGTGCAAAGT
TAGGATGAAAATAAGCTTGAGTATTTAAAAAATTTATTCAATACTCCTATTGAGCGTAAA
TATTTATTTAAATAATAATAAAAATTTAATGTTTCATTAATAATTGCATAACATTAATGA
GCACTTCTTATAAACTAAATAGGGAAATTTGCTTTATCTTTTCTATTTATCAAGATAACA
ACGATATATATAATTTTTTATGAAAAATCTGAGCTCAAATAAGATTATCCAATCAAATTT
TAGGATTTTTATTTCATATATATCTAATTATTTTTGATTTATGAATTTATTAGAATTATT
TTGTTTTATAAAAATTAACAATTACAAAATTTTATAATTTTTCATTTTAAATTCATAAAA
GCTGACAATTAGGAGTTAGAATGGGACGATTGGAGAGCTTAGCTAGCTGTTTAATATATC
TTAGATGAATCTGTCCAAAGGTAGTATTAAGATGATGACTTATCTAATCTAAACTATGAA
AATCTGCTACTTCATATGAGAATTACTTTTCTTATTGCTAATCAATATATTAAGGATAAA
TCTCTCATATAAAAAATATTGCAAACCAAAAAGAAATAAATTCCTAAAAATTCATCTAGT
TATTAAAGCTAACTTGAAGCATTTCAAAATGAAAAAAACTAATTGCTATAGATTATCTAG
AATATTGCTTAAAACTCATAATTATACAAAGAAATACAAGAAGAAGAAGATCAACTGTTG
GAGGAAACTGTAAAATTAAAAGAAGAATTAAAATAAATAAATCAACAAAATCATAAGAAT
ATTTAAAGGTAAAATCAAAAAATACACATATCAGAAAATGGCATTAAAGTTTTTTATTTA
AAAATAATTTATTCAGATTAGAGCAGCAACTTAAAATGGAATTTTGTAAGTAGCAAATGA
TATATTTGGAAACAGATTATATTCTTTCAAAGTCTAAAAATGAAAATATTCACATACAAA
AAGATTATAATGAGGAACAAAAGCACCTTTTGCTTGAGAAACACTTTGCTAAAATGGAGA
ATATGAATTTGTAGGCTTCATTTTTACATTAAACTATTTTAAGATTGGAGAAGAAATAGC
TTTCGGAAACTATTTCATGCATTACTGGATACACAAACAAATACAATTAGCCATAATTTG
AATTAAGGTTTGAGTCAGCTTATAATGATTCAGCAGAATGGATAAGTGAGTAGTTATTAG
ATGAGTTGAACTCTTTAAGAGATTAAAATTTATTTTCTTTTTATAACATTCCTTAAAAAA
CGCTGTATTCTCATATAGCAAACAACGTAAAATAGATAAATTATAAAATAAAAACAATAA
AAATATATATAATTTTATAAAGTTTTTAGGATGGAATTATATATAAAAAAACAGAGATAA
GCCAAACTAATTGAAGCTAAAAAATATTAAGGATTTGATAACTTAAAAAGAATAACCTGG
AAATAAAATGAATTAGTATGAAATATGTCATCACTGTAAACATTTGTTTAAAAAGAGTAT
TCTTTTTTAATGCAAGTATAAAGCATCTACTATGGGAATACCTGTCCATAATTATATTGT
TACTGATCCCTTCTTATTTTAATTTAGTAAACAATTATTTTTTTAATAGCTTTGAAAGAA
ATTTTATTTAATTTAGTTGAATCTGACAATACAAACAGTAAGAAGCCTCAAGTCAACAAA
AAAAGAAACTGCTATACTATGTTCTAAAAAGTAGATGGAGATTTGGTTTGCAAAAGAATG
TACTGTAGATCTTGTCTAAAATAAAATTACGATTTAATTCTTTCAGAAATTAAAGATAAG
TAAGATTGGCTTTGCCCTTTCTGCTAAGTAAAATTAAAATAGTATTTTAAGAAAAGCATG
AATTAAAAATATATTTCAAAAGGGAAATTGTTATTGTACTAGATGTCTTCGAAATGAATT
ACTCATGAAATACAAAGGAATTTATATTTTATTAGGAGGAGATATTAATTTAATTCAAAG
AGAATCTGTGTTTGAATATTATTCTCAGCAGATGTCCTAGCAAAGAGTATTTTTAACATT
TTAATTATTTTATTTAACTTTTTTTTAGTAAAGAGAATATTAAGAGTAGCAATTAAACAT
GAATAGCAGAGGTATAAAAAATTCAGTAAAAGGATTAAAATTAAAAGATGAACACACATA
AAAAATAGTTGAAGTTGAGAGATTAAAGTAATTATGTCAATAAGTGAATAAAAGAGAAAA
ATATAAATTTGAAATGCTGAAATAGAATATAGATATATTTAGAGAAAAGTATAAAACTCA
CACTGATAAAGAATTCCCCATAGTTGACATAAATAATTTGAATACACAAGAATTTATTGC
AGACTTATTACCTTTCCAAAATGAACTAGTTATAAATACAATAAGTAAAAATAATTTTAT
CTAAAAAAATAAATTTAATCTTTAATTAAAAATTAGATAACTTTCAAAAAAACAACTAAA
TAATAGGCAAAAACTTAACAAAAAATAGCAGTAATAAAATAAAAATGATTCAAATTAACA
AACTTTTCAAAAAGAAAAATAAAAAATAAAAAAATGATGATGATGATGAAGAAAATAATA
TTCAATAGGAAAATTCAGTTAAGAGTTACACTTCTTAAAACTCTTCATCAAATTCATAAT
CTTAGTCACAATCATCCATAAATTCAAAAGGAGATGAAAGAATAGCTAGTGGTGTGTAAA
GAAAGAAAGCTTAATCATTAAAAATAAATAAGTTAATTAAAAAAACAAAAACAAGTAGTA
AAGTCATGCTTAAAAAGAGCAATAAGAAGGGTAATTAGAGGGACTGA