Identifiers and Description

Gene Model Identifier

TTHERM_00420220

Standard Name

None

Aliases

PreTt07147 | 46.m00202 | 3679.m00052

Description

cyclin-dependent kinase-like Serine/Threonine kinase family protein; Protein kinase domain containing protein. Sequence similarity to the STE11 protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF08175 ) Small acid-soluble spore protein O
  • ( TIGR00042 ) non-canonical purine NTP pyrophosphatase, rdgB/HAM1
  • ( PF08541 ) 3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III C

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00420220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11046.19.997093137033517e-262protein kinase domain-containi
ng protein (830 aa)
OxytrichaContig12730.0.g651.000371485572848e-69Protein kinase domain
DictyBaseDDB_G02832655.002115178225629e-63mkkA on chromosome: 4 position
530684 to 534789
SGDYLR362W2.0008958828286524e-54STE11 Signal transducing MEK k
inase involved in pheromone re
sponse and pseudohyphal/invasi
ve growth pathways where it ph
osphorylates Ste7p, and the hi
gh osmolarity response pathway
, via phosphorylation of Pbs2p
; regulated by Ste20p and Ste5
0p
WormBaseWBGene000015263.0009061039838537e-46locus:gck-1 status:Partially
_confirmed UniProt:Q6ABW4
protein_id:CCD72153.1
Stentor CoeruleusSteCoe_326924.4737793061811207e-38

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420220(coding)
ATGGGTTGTGGCGCATCAAATCACAAAGGCGAAGTTGCTGAACCTCAGCCTGTGGGTAAC
AAAAAAGGTTTAGAATAAAAAGAGAATTAAGTGCAGAAAAATAAAAAAAATAAATAAAGT
GAAGATGTTGTTATATAAGACTTAGACGCATAAGAAGACATTAGGACAGAATCCAAGTTC
TCTCCAAGCAAAGGAAATATTTTAGCTAATTAAAATTTAGATGGCAGTGCCAATAATATA
AAAGAAGATGAGAATCAAAACAATTAGAATATTTAATTGAAAAGATATAAAAAATGTGAG
CTTATTGATAAAGGAGCTTATGGTAAAGTTTATAAAGGGATAGATACAATAACAAATCAA
GTTGTTGCAATAAAATATATTGAAATAACTGGTACATTTGAAGAAGTAAAAAAGGAAATA
AACTCTTTGAAAAAGGAAATTGTTTTACTCAAAAAATTAAATCATCAAAACATAGTAAAA
TATTATGATTTTGAAATAAGCGATGATAAATCAGGTGTTGATATCATTTTGGAGTACGTT
CCAAACGGTTCTTTAAGAATGGCCTTAAATAAATAAAGATGTTTTGATGAAACAAAAGCA
GCTATTTACACTAAGCAAGTTTTAGAAGGTTTAGATTATTTGCATAAAAACAATATCATT
CACAGAGATTTAAAAGGAGCAAATTTATTGCTGGATGCTGAAGGTAGGGCCAAACTAACT
GACTTTGGAACCGCTAAATAGATTGAATTTGATTTGAGAAAATCTTAAGTCAAAGAAGAA
GATATTGCTAAAATGAATAAGTCTCTTAAAGGCACACCAAATTGGATGGCTCCAGAGGTA
ATTGAAAGAACTGGACATACAACTTCTGCAGATATATGGAGTATAGGATGTATAGTGATT
GAAATGATTACAGGAAAGCCTCCTTATCCTGGATTATCTGCCAAAGAAGTTTTTACTAAA
ATTGCATCTGGAGTATTACCAGATTTTCCAAAGGGGATATCATTTGAATGTAAGGAGTTT
TTAGAAGGGTGTTTATAAACTGATCCTAAAAAAAGACTTACAACTTCTCAACTATTGAAG
ACACCTTTCATTTTAAGAAAAAAAATTAGAAGACCCTTAAGCTAAAATAGCTTAGTTTCA
TAGGAGGAATTGCTAGAGTAAATTTAAAGCATTCAGCAAGGGTAAAATATTTAATAAGAA
TACTCAAGGATAAATAAAGGAAGCCAGCCATTAATTAAAGGTAATAGCAGTTAAAGCATA
AAAGTACCTCAAATTATTTCAAATCAAAATGCTTCTTCCTAGCCCTTGATAGTAAATAAA
CCAAATCCTTATTTAGAGTACTAGTATAAGAACTAGTAAAAATATCAAGAATATTAAGAT
TCTCAGATTGATCAACTAAAAGAAAGGACAAAGAGTCTCAACAGATTTGCTAATGAACAT
AAAAGTAGTACATAGAATGATAAATAATAGAATTAAATAAGAAAAATTGACTAACAAACT
AATAAAAATATTAATGCTGAGGATGAAATTCTATAAATTGCAAAATAAGTTAAGAGATAA
TAAGAATATGTTCAAGCTAATGTTAACCCTGGATATGATTAATACATTTTCAAACCATAA
GTTGAAAGTAATGTAATCAAATTTTCAAATAAAGATCACGATGTTCACTCAAATAATTAA
AATGACTTCAATCCTTTAAGAAGCAACTCAAGATAGAATACATATAGTTAATTAAAAATA
TAGCCTGATATTCATGCAAATAATTAAAACGAATTCAATCAGTAAAGAAATAACTCAAGA
TAAAATACATACAGCTAGTAAAAAGGTTAATAACCATAGCAACCTTTTAGATCCTCTTTA
GTTGATATCAAAGATGAAGATGACATGGATACAACAGAAATGATCAGAAGATCACAAAAA
TCACTTACTCTTTTGAAATCTAAATATAAAAACTTGAATGAGGCTTCTTCTTAAGGTAAA
GATAATTAGATTGCTAGTTAAAATGAATAAGCTCTAAGTAACTACCACTTAAACCATTCT
TAGAAATAAAACCATAAATCTTCTTATGAAGACTTAGATATAGAACTCCCTTAAGAAAGT
AAAGAAGTTCCTATATCAAGAAATGTGGGTAGATAAAATAGCTAGATAACTATTAGTAAA
GAATAACCTTTGTAGTAAGAAAGTGTAACCGAAGAAGTTATTGAAACAAACCAATCTGAA
CCCTAAGAAGAAAATGAGTATCTAAAACATGAAAACAAGGTGATCACTACAAAAGCTGCT
AACGTGCAAAGAATGATGCTAAACAAATAGCTAGCAAATAAATAGTAAAAATAGCAACAA
AATTTCATACCAAACAAATACTTCGAGCATTAAAATTAGGTAATAAATACTGATATTGCA
CAAAGAGAAAGAAATATAAGAATTCAAGAATAGCAAGAATTTATCCAAGACAAAATAAAA
AGATAGTAAATGTGGGAAGAGGAGCTTAAAAGAGAACTTGAGTATTAAAAGCAGAACCCT
CCTCCCTACTTGAAGTATTGA


>TTHERM_00420220(protein)
MGCGASNHKGEVAEPQPVGNKKGLEQKENQVQKNKKNKQSEDVVIQDLDAQEDIRTESKF
SPSKGNILANQNLDGSANNIKEDENQNNQNIQLKRYKKCELIDKGAYGKVYKGIDTITNQ
VVAIKYIEITGTFEEVKKEINSLKKEIVLLKKLNHQNIVKYYDFEISDDKSGVDIILEYV
PNGSLRMALNKQRCFDETKAAIYTKQVLEGLDYLHKNNIIHRDLKGANLLLDAEGRAKLT
DFGTAKQIEFDLRKSQVKEEDIAKMNKSLKGTPNWMAPEVIERTGHTTSADIWSIGCIVI
EMITGKPPYPGLSAKEVFTKIASGVLPDFPKGISFECKEFLEGCLQTDPKKRLTTSQLLK
TPFILRKKIRRPLSQNSLVSQEELLEQIQSIQQGQNIQQEYSRINKGSQPLIKGNSSQSI
KVPQIISNQNASSQPLIVNKPNPYLEYQYKNQQKYQEYQDSQIDQLKERTKSLNRFANEH
KSSTQNDKQQNQIRKIDQQTNKNINAEDEILQIAKQVKRQQEYVQANVNPGYDQYIFKPQ
VESNVIKFSNKDHDVHSNNQNDFNPLRSNSRQNTYSQLKIQPDIHANNQNEFNQQRNNSR
QNTYSQQKGQQPQQPFRSSLVDIKDEDDMDTTEMIRRSQKSLTLLKSKYKNLNEASSQGK
DNQIASQNEQALSNYHLNHSQKQNHKSSYEDLDIELPQESKEVPISRNVGRQNSQITISK
EQPLQQESVTEEVIETNQSEPQEENEYLKHENKVITTKAANVQRMMLNKQLANKQQKQQQ
NFIPNKYFEHQNQVINTDIAQRERNIRIQEQQEFIQDKIKRQQMWEEELKRELEYQKQNP
PPYLKY


>TTHERM_00420220(gene)
ATGGGTTGTGGCGCATCAAATCACAAAGGCGAAGTTGCTGAACCTCGTAGCAGATTTATT
TTTTTAAATGCAATTTAATAATTTTAACAATTTCGTAAAATTTGAATAGAGCCTGTGGGT
AACAAAAAAGGTTTAGAATAAAAAGAGAATTAAGTGCAGAAAAATAAAAAAAATAAATAA
AGTGAAGATGTTGTTATATAAGACTTAGACGCATAAGAAGACATTAGGACAGGTACAAAA
AAATTTAAGAAATAATTTAATTCAGTAAAAATATTTTGATACAGAGTTTTTGATTGAAAT
TTAGCAAAGCATCTATCTATAGTTGTTAGTTAACTGAAGGAATTAATATTTATAATTTAT
ACTATTAAAATAGAATCCAAGTTCTCTCCAAGCAAAGGAAATATTTTAGCTAATTAAAAT
TTAGATGGCAGTGCCAATAATATAAAAGAAGATGAGAATCAAAACAATTAGAATATTTAA
TTGAAAAGATATAAAAAATGTGAGCTTATTGATAAAGGAGCTTATGGTAAAGTTTATAAA
GGGATAGATACAATAACAAATCAAGTTGTTGCAATAAAATATATTGAAATAACTGGTACA
TTTGAAGAAGTAAAAAAGGAAATAAACTCTTTGAAAAAGGAAATTGTTTTACTCAAAAAA
TTAAATCATCAAAACATAGTAAAATATTATGATTTTGAAATAAGCGATGATAAATCAGGT
ATTTATTTTTACTATCTTAGCCTATTATTAAAGTAAAAATTTTTTTTAAAGGTGTTGATA
TCATTTTGGAGTACGTTCCAAACGGTTCTTTAAGAATGGCCTTAAATAAATAAAGATGTT
TTGATGAAACAAAAGCAGCTATTTACACTAAGCAAGTTTTAGAAGGTTTAGATTATTTGC
ATAAAAACAATATCATTCACAGGTTAGTTTGATTTCTCATTTTAATGATTATTTAGCTAT
TTTTAGAGATTTAAAAGGAGCAAATTTATTGCTGGATGCTGAAGGTAGGGCCAAACTAAC
TGACTTTGGAACCGCTAAATAGATTGAATTTGATTTGAGAAAATCTTAAGTCAAAGAAGA
AGATATTGCTAAAATGAATAAGTCTCTTAAAGGCACACCAAATTGGATGGCTCCAGAGGT
AATTGAAAGAACTGGACATACAACTTCTGCAGATATATGGAGTATAGGATGTATAGTGAT
TGAAATGATTACAGGAAAGCCTCCTTATCCTGGATTATCTGCCAAAGAAGTTTTTACTAA
AATTGCATCTGGAGGTATGTTTTTGAAACAAATTTTTTTTAATTATTTAAAATAACTAAT
TAATTAAAATAGTATTACCAGATTTTCCAAAGGGGATATCATTTGAATGTAAGGAGTTTT
TAGAAGGGTGTTTATAAACTGATCCTAAAAAAAGACTTACAACTTCTCAACTATTGAAGA
CACCTTTCATTTTAAGAAAAAAAATTAGAAGACCCTTAAGCTAAAATAGCTTAGTTTCAT
AGGAGGAATTGCTAGAGTAAATTTAAAGCATTCAGCAAGGGTAAAATATTTAATAAGAAT
ACTCAAGGATAAATAAAGGAAGCCAGCCATTAATTAAAGGTAATAGCAGTTAAAGCATAA
AAGTACCTCAAATTATTTCAAATCAAAATGCTTCTTCCTAGCCCTTGATAGTAAATAAAC
CAAATCCTTATTTAGAGTACTAGTATAAGAACTAGTAAAAATATCAAGAATATTAAGATT
CTCAGATTGATCAACTAAAAGAAAGGACAAAGAGTCTCAACAGATTTGCTAATGAACATA
AAAGTAGTACATAGAATGATAAATAATAGAATTAAATAAGAAAAATTGACTAACAAACTA
ATAAAAATATTAATGCTGAGGATGAAATTCTATAAATTGCAAAATAAGTTAAGAGATAAT
AAGAATATGTTCAAGCTAATGTTAACCCTGGATATGATTAATACATTTTCAAACCATAAG
TTGAAAGTAATGTAATCAAATTTTCAAATAAAGATCACGATGTTCACTCAAATAATTAAA
ATGACTTCAATCCTTTAAGAAGCAACTCAAGATAGAATACATATAGTTAATTAAAAATAT
AGCCTGATATTCATGCAAATAATTAAAACGAATTCAATCAGTAAAGAAATAACTCAAGAT
AAAATACATACAGCTAGTAAAAAGGTTAATAACCATAGCAACCTTTTAGATCCTCTTTAG
TTGATATCAAAGATGAAGATGACATGGATACAACAGAAATGATCAGAAGATCACAAAAAT
CACTTACTCTTTTGAAATCTAAATATAAAAACTTGAATGAGGCTTCTTCTTAAGGTAAAG
ATAATTAGATTGCTAGTTAAAATGAATAAGCTCTAAGTAACTACCACTTAAACCATTCTT
AGAAATAAAACCATAAATCTTCTTATGAAGACTTAGATATAGAACTCCCTTAAGAAAGTA
AAGAAGTTCCTATATCAAGAAATGTGGGTAGATAAAATAGCTAGATAACTATTAGTAAAG
AATAACCTTTGTAGTAAGAAAGTGTAACCGAAGAAGTTATTGAAACAAACCAATCTGAAC
CCTAAGAAGAAAATGAGTATCTAAAACATGAAAACAAGGTGATCACTACAAAAGCTGCTA
ACGTGCAAAGAATGATGCTAAACAAATAGCTAGCAAATAAATAGTAAAAATAGCAACAAA
ATTTCATACCAAACAAATACTTCGAGCATTAAAATTAGGTAATAAATACTGATATTGCAC
AAAGAGAAAGAAATATAAGAATTCAAGAATAGCAAGAATTTATCCAAGACAAAATAAAAA
GATAGTAAATGTGGGAAGAGGAGCTTAAAAGAGAACTTGAGTATTAAAAGCAGAACCCTC
CTCCCTACTTGAAGTATTGA