Identifiers and Description

Gene Model Identifier

TTHERM_00420020

Standard Name

MCF5 (Mitochondrial Carrier Family 5)

Aliases

PreTt07127 | 46.m00182 | 3679.m00032

Description

Mitochondrial carrier protein; facilitates transport across mitochondrial membranes, possible homolog of S.cerevisiae ORT1 "ornithine transporter of the mitochondrial inner membrane".

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein
  • ( TIGR00119 ) acetolactate synthase, small subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.8%

TetraMine Data

TTHERM_00420020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11065.19.997093137033517e-262mitochondrial carrier protein
(320 aa)
DictyBaseDDB_G02909131.999534248571833e-46mcfS on chromosome: 5 position
4740703 to 4741678
SGDYPR058W2.99915080840225e-45YMC1 Mitochondrial protein, pu
tative inner membrane transpor
ter with a role in oleate meta
bolism and glutamate biosynthe
sis; member of the mitochondri
al carrier (MCF) family; has s
imilarity with Ymc2p
WormBaseWBGene000083201.0003081162615753e-33status:Partially_confirmed U
niProt:Q18844 protein_id:CAA
99811.1
OxytrichaContig13637.0.1.g281.0002124404074584e-26Mitochondrial carrier protein
Stentor CoeruleusSteCoe_354635.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000200

Sequences

>TTHERM_00420020(coding)
ATGTAATAATATTTCTAAGTATATTATTTAGTAATTAGTACTTTCTTTTAGAAAATTAGC
AGAAATTTCCTAATTAATCTCTTTTTTCAGCCAAGCAATATGACAAACTAAGCAAGCAGC
AATCAACTAGCCCCGGCTTTAGGATACCAAAAAATACCAGTCTAATAGTAACATATCAAG
AAACTGACAGTAGATTTATTAGCAGGAATGATTACAGGATGGGTTTCTGTAATAACCTTG
CAACCTCTAGATATGATCAAAACAACCATGCAAACAAGCTCCAACAAACAAAGCATATTA
GGTTGTGCAAAAGAAATATACTAAAAGTCAAAAATGAAAGGTTTTTATAAGGGTATGCTC
TTTCCTTTGATAGGCTCTAGCTTTTTTTCTGCCATTTACTACGGTTCTAATGAATAGATG
AAAAAATTAATATGCTTTTTATCGAATCACAAGTATGATAGAACTAGCTTGCCATTATAA
TATGTTTTCTTTTCAGGATCTTTTGCTGGTTTAACTACTTCATGTGTTTCTATTCCTATA
GAGCATGTAAAAATAAGACTATAAACATAAAAAAACCAATAATATACTGGCTCAATTGAT
TGCTTTAAAAAGATATTAAGAAATCATGGTGTAGTAGGACTTTACAAATCATCTATCCTT
TAATTATCAAGAGATTTTATAGGCTGTGGAAGCTTTTTTGTAATGTATGATATAACAAAG
AGATACTTCAAAAAGTAAAATAATGGAGAATTAGATAAATTAAGATTGTTTTTAAGTGGG
TGTGTAGCTGGAATGTCATATTGGCCTCTCTGCTTCCCACTAGATGTAATTAAAACAAAA
ATGCAGAGTGATTCATTCGTTAAACCCTAATTTTAAAATATAAAAGACTGTGCTCTTCAA
ATTTATAGATATGAAAATAGGGGATTTTTAAATTTTTATAAAGGATTTTTAATAAGTAAT
ATAAGATCTATTCCTAACTCAGCTATTGCACTTTTTACCTTTGAAAATGTTTTAGGATTT
CTTTCTAAATTATTTGGAATTCAAAAACCCAAGCATTGA


>TTHERM_00420020(protein)
MQQYFQVYYLVISTFFQKISRNFLINLFFQPSNMTNQASSNQLAPALGYQKIPVQQQHIK
KLTVDLLAGMITGWVSVITLQPLDMIKTTMQTSSNKQSILGCAKEIYQKSKMKGFYKGML
FPLIGSSFFSAIYYGSNEQMKKLICFLSNHKYDRTSLPLQYVFFSGSFAGLTTSCVSIPI
EHVKIRLQTQKNQQYTGSIDCFKKILRNHGVVGLYKSSILQLSRDFIGCGSFFVMYDITK
RYFKKQNNGELDKLRLFLSGCVAGMSYWPLCFPLDVIKTKMQSDSFVKPQFQNIKDCALQ
IYRYENRGFLNFYKGFLISNIRSIPNSAIALFTFENVLGFLSKLFGIQKPKH


>TTHERM_00420020(gene)
GTTCCTAAGTTTTAATGTAATAATATTTCTAAGTATATTATTTAGTAATTAGTACTTTCT
TTTAGAAAATTAGCAGAAATTTCCTAATTAATCTCTTTTTTCAGCCAAGCAATATGACAA
ACTAAGCAAGCAGCAATCAACTAGCCCCGGCTTTAGGATACCAAAAAATACCAGTCTAAT
AGTAACATATCAAGAAACTGACAGTAGATTTATTAGCAGGAATGATTACAGGTAACATTT
TTAAATAATCATATATTTATCCATAGGGATTTTACTATTGCAGTTAAAAAATAATTAGAA
CAAACTTATGACAAAAATTAAAATTATTTTATTGAATTTTTGTTTATGCCTTGTTTATTA
CTTTAAATTTAGGATGGGTTTCTGTAATAACCTTGCAACCTCTAGATATGATCAAAACAA
CCATGCAAACAAGCTCCAACAAACAAAGCATATTAGGTTGTGCAAAAGAAATATACTAAA
AGTCAAAAATGAAAGGTTTTTATAAGGGTAAATTAAAATTTAATATAGTATGAGAAATCT
TAATCTTTCTTATCAATAAAGGTATGCTCTTTCCTTTGATAGGCTCTAGCTTTTTTTCTG
CCATTTACTACGGTTCTAATGAATAGATGAAAAAATTAATATGCGTAATATAAAATAATA
TTTTTTATATGGATTATTAAAGCACACTTTCTTTAAATTAGCTTACTTATTTTATGATTT
TTAATTTTATATTATAAATTTTACAGTTTTTATCGAATCACAAGTATGATAGAACTAGCT
TGCCATTATAATATGTTTTCTTTTCAGGATCTTTTGCTGGTTTAACTACTTCATGTGTTT
CTATTCCTATAGAGCATGTAAAAATAAGACTATAAGTAGACCTTTATTAAATTTAATTTA
ATTAAGTTAAATAAACCTATTTAAATAAAATATTTAGACATAAAAAAACCAATAATATAC
TGGCTCAATTGATTGCTTTAAAAAGATATTAAGAAATCATGGTGTAGTAGGACTTTACAA
ATCATCTATCCTTTAATTATCAAGAGATTTTATAGGCTGTGGTAAGATAAATTTTTTTGG
TTATGAATTCAAATCATTTTTAATTGTTTAGGAAGCTTTTTTGTAATGTATGATATAACA
AAGAGATACTTCAAAAAGTAAAATAATGGAGAATTAGATAAATTAAGATTGTTTTTAAGT
GGGTGTGTAGCTGGAATGTCATATTGGCCTCTCTGCTTCCCACTAGATGTAATTAAAACA
AAAATGCAGAGTGATTCATTCGTTAAACCCTAATTTTAAAATATAAAAGACTGTGCTCTT
CAAATTTATAGATATGAAAATAGGGGATTTTTAAATTTTTATAAAGGATTTTTAATAAGT
AATATAAGATCTATTCCTAACTCAGCTATTGCACTTTTTACCTTTGAAAATGTTTTAGGA
TTTCTTTCTAAATTATTTGGAATTCAAAAACCCAAGCATTGAATTAAAGTGCTGCTAAAA
TATTATTTAATTTATGCTTTTCGTGTTTAATAAAAATAATTTATTTATTTTTTATAAATA
ATCATCATTTAATTAGAATTAAGATAAAGGCCATATGGCTTAAAATAAATTAACTTAATT
TGTATTCATGATAAGTTAATTAATTTGACCAAACATTGAAACTACACTAA