Identifiers and Description

Gene Model Identifier

TTHERM_00420010

Standard Name

None

Aliases

PreTt07126 | 46.m00181 | 3679.m00031

Description

SAM domain and HD domain protein; HD domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00420010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11066.19.997093137033517e-262HD domain-containing protein (
574 aa)
OxytrichaContig10619.0.g412.0008312485874125e-83HD domain
DictyBaseDDB_G02724845.001369568193564e-73DDB_G0272484 on chromosome: 2
position 1760557 to 1762209
Stentor CoeruleusSteCoe_231992.4426007377405277e-36
WormBaseWBGene000226739.000751454575209e-33Uncharacterized protein ZK177.
8 status:Confirmed UniProt
:Q09374 protein_id:CCD64861.
1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420010(coding)
ATGAATCCTGAAAAATTATCAGTTCCTAAAGTTCTTAGAAATCTTGAAGAATTCTCACAA
TGTTAAGATCTTTAAGACCATTCTTACTTTTATTTTGATCAAAATTCAATCAATCCTTAC
AAGGAAATAGAACCTAACTGGGATGAAACAAGAAGAATTAGTGACCCTATTCACTAATTC
ATAGAACTACCCAAATCAATTTGGCGTATAGTAGATACTGAAGAATACTAGAGATTAAGA
TACATAAAGTAACTAGGCATGACCGGATTTGTATTTAATGGAGCTAATCACACAAGATTT
GAGCACTGTTTAGGTGTTGCTCATTTATCTTGGACCTATTTAGACAAAATAGCAATGAAT
CACTAGTATAAGTTTGAGCAAATGGGACTTAAAGACGCAGACCATTTTGATTAGATAAAG
TTATTAGTTACAATTGCAGGACTTTGTCATGATTTAGGACATGGCCCCTTTTCTCATATG
TTTGATAATATTCTCCTCCCTCGTTTAGGAGAAAAAAAATGGAAACATGAGGAAGGTAGC
TGCATGATGCTTAGATCCATTCTACTAAGTGAAGAAAAAGATTTTATGACCAACTTAGTT
ACTTACAAAAATGCAAAATTAAATCCAAAAGAAGATATTGAAGTCATTTTAGATATGATC
GAAGGATTAACTTTAAGCCAATGGAAAGATAAATATGAAGAAAAAAAGTAATATCCAAAA
TGGGTATTTGATATTGTATCAAATAAAACCACCTCGATTGATGTGGATAAGCTTGACTAT
TTGAAAAGAGATCCTTCATGCTTGAATGTTAAGCACGAGTTCGACTATAATATTCTATTT
AATGAAACTCGTATTATAGATGGAGAAATATGTTACAATAGCAAAATTCATGACACAATA
TATGATATTTTCCATATTAGATATAAACTTTTTAAGCATATTTATTTACATAGAGTGACT
TAGGCTATAGAGCTTATGCTTTGTGATGCCCTTGAAAAAGCAAACCCAGTATTTAACTTT
TTAGAAACCATTAAATCACCATAAAGATACTTAAGACTTACAGATTCTATCATAGAAATA
ATTTTGGGTTCAGAAGATTGTGAATTAGCTGAATCATAATAACTCTTGAAAAGAATATTC
ACAAGAAAGATTTACAAATTCGTTGGTGAAATAGTTATTGACTAATAAAAAGATTTGACT
GAATCTCAAGTTTTAGATGGCATTTCTAGAAACAATTAATATAGACCATCATTTTCTTGT
TCAAGTACAAAACTCAATGACTTCGAAAGAAAAAATACTATAGTGACTTTTTCTAAAATC
AATTATTGTATGAAAGACTAAGATCCTGTTAATAATTGCTACTTCTTTAAATCTTCATAG
CCATTTGAGAAAAAAAAATTACCAGCTTAAAATTCCTCTTTGTTAAGACCACAGAAGTTT
GGAGAATAAATCATTAGAGTCTTTGTTAAAGAAAATGATGAAGTTTTAATAAATAAAGTA
AAGAATGGATTTGCACTTTATACACAAAAAGAACTTCATACCGAAACTGGTGCTTACGAT
AAAAAAGATCATTAAAAAACACCTAATAAATCAGAGCCTTAAAAAAAATTCAAGTTGAGT
AGTCCTTAATATGAAAACAATGAAAATACCAACCAAAAGTAAATGAATATTATAATTAAT
GACGGCTCTTAATATTAATTAAATACTAAAACATTATTTTAAAATGATGATTGA


>TTHERM_00420010(protein)
MNPEKLSVPKVLRNLEEFSQCQDLQDHSYFYFDQNSINPYKEIEPNWDETRRISDPIHQF
IELPKSIWRIVDTEEYQRLRYIKQLGMTGFVFNGANHTRFEHCLGVAHLSWTYLDKIAMN
HQYKFEQMGLKDADHFDQIKLLVTIAGLCHDLGHGPFSHMFDNILLPRLGEKKWKHEEGS
CMMLRSILLSEEKDFMTNLVTYKNAKLNPKEDIEVILDMIEGLTLSQWKDKYEEKKQYPK
WVFDIVSNKTTSIDVDKLDYLKRDPSCLNVKHEFDYNILFNETRIIDGEICYNSKIHDTI
YDIFHIRYKLFKHIYLHRVTQAIELMLCDALEKANPVFNFLETIKSPQRYLRLTDSIIEI
ILGSEDCELAESQQLLKRIFTRKIYKFVGEIVIDQQKDLTESQVLDGISRNNQYRPSFSC
SSTKLNDFERKNTIVTFSKINYCMKDQDPVNNCYFFKSSQPFEKKKLPAQNSSLLRPQKF
GEQIIRVFVKENDEVLINKVKNGFALYTQKELHTETGAYDKKDHQKTPNKSEPQKKFKLS
SPQYENNENTNQKQMNIIINDGSQYQLNTKTLFQNDD


>TTHERM_00420010(gene)
ATGAATCCTGAAAAATTATCAGTTCCTAAAGTTCTTAGAAATCTTGAAGAATTCTCACAA
TGTTAAGATCTTTAAGACCATTCTTACTTTTATTTTGATCAAAATTCAATCAATCCTTAC
AAGGAAATAGAACCTAACTGGGATGAAACAAGAAGAATTAGTGACCCTATTCACTAATTC
ATAGAACTACCCAAATCAATTTGGCGTATAGTAGATACTGAAGAATACTAGAGATTAAGA
TACATAAAGTAACTAGGCATGACCGGATTTGTATTTAATGGAGCTAATCACACAAGATTT
GAGCACTGTTTAGGTGTTGCTCATTTATCTTGGACCTATTTAGACAAAATAGCAATGAAT
CACTAGTATAAGTTTGAGCAAATGGGACTTAAAGACGCAGACCATTTTGATTAGATAAAG
TTATTAGTTACAATTGCAGGACTTTGTCATGATTTAGGACATGGCCCCTTTTCTCATATG
TTTGATAATATTCTCCTCCCTCGTTTAGGAGAAAAAAAATGGAAACATGAGGAAGGTAGC
TGCATGATGCTTAGATCCATTCTACTAAGTGAAGAAAAAGATTTTATGACCAACTTAGTT
ACTTACAAAAATGCAAAATTAAATCCAAAAGAAGATATTGAAGTCATTTTAGATATGATC
GAAGGTAATTTATTTACAATTATTATTTATATTAAGATCAAAGGACTTATCATTTTTCAA
TATCAACAAAGGATTAACTTTAAGCCAATGGAAAGATAAATATGAAGAAAAAAAGTAATA
TCCAAAATGGGTATTTGATATTGTATCAAATAAAACCACCTCGATTGATGTGGATAAGCT
TGACTATTTGAAAAGAGATCCTTCATGCTTGAATGTTAAGCACGAGTTCGACTATAATAT
TCTATTTAATGAAACTCGTATTATAGATGGAGAAATATGTTACAATAGCAAAATTCATGA
CACAATATATGATATTTTCCATATTAGATATAAACTTTTTAAGCATATTTATTTACATAG
AGTGACTTAGGCTATAGAGCTTATGCTTTGTGATGCCCTTGAAAAAGCAAACCCAGTATT
TAACTTTTTAGAAACCATTAAATCACCATAAAGATACTTAAGACTTACAGATTCTATCAT
AGAAATAATTTTGGGTTCAGAAGATTGTAAGTTTTTCATTATTTTTTATGATTTTGAAAT
CATTTCATTTATTTGAAAAGTGTTTATTGATATTTTAAAAACAATTTTGATTTAATCTAT
AAAAGCATTTAATTATTTATCTTTTATTTGCCTTAACTTTAAATTTTATAAAATTAAATT
TAAATCCAATCTATGTCTTTATTAATTTTAATTTTTAAATCATTCAATAGGTGAATTAGC
TGAATCATAATAACTCTTGAAAAGAATATTCACAAGAAAGATTTACAAATTCGTTGGTGA
AATAGTTATTGACTAATAAAAAGATTTGACTGAATCTCAAGTTTTAGATGGCATTTCTAG
AAACAATTAATATAGACCATCATTTTCTTGTTCAAGTACAAAACTCAATGACTTCGAAAG
AAAAAATACTATAGTGACTTTTTCTAAAATCAATTATTGTATGAAAGACTAAGATCCTGT
TAATAATTGCTACTTCTTTAAATCTTCATAGCCATTTGAGAAAAAAAAATTACCAGCTTA
AAATTCCTCTTTGTTAAGACCACAGAAGTTTGGAGAATAAATCATTAGAGTCTTTGTTAA
AGAAAATGATGAAGTTTTAATAAATAAAGTAAAGAATGGATTTGCACTTTATACACAAAA
AGAACTTCATACCGAAACTGGTGCTTACGATAAAAAAGATCATTAAAAAACACCTAATAA
ATCAGAGCCTTAAAAAAAATTCAAGTTGAGTAGTCCTTAATATGAAAACAATGAAAATAC
CAACCAAAAGTAAATGAATATTATAATTAATGACGGCTCTTAATATTAATTAAATACTAA
AACATTATTTTAAAATGATGATTGA