Identifiers and Description

Gene Model Identifier

TTHERM_00419930

Standard Name

None

Aliases

PreTt07118 | 46.m00173 | 3679.m00023

Description

kelch motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00419930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11073.19.997093137033517e-262kelch domain-containing protei
n family protein (666 aa)
OxytrichaContig20663.0.g919.998720540547892e-23Kelch motif
WormBaseWBGene000082670.000000000010004361180063202status:Partially_confirmed U
niProt:O17700 protein_id:CAB
03989.2
DictyBaseDDB_G02713720.00000000009998509410508463DDB_G0271372 on chromosome: 2
position 117705 to 120704
SGDYGR238C0.00000019998969434520019KEL2 Protein that functions in
a complex with Kel1p to negat
ively regulate mitotic exit, i
nteracts with Tem1p and Lte1p;
localizes to regions of polar
ized growth; potential Cdc28p
substrate

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00419930(coding)
ATGTTTAAATATTCAAATTAGGAATACTAAAAAAAAACTTTAGCCACAGGAGACATAGAT
CCTTATAATTACAATAGGGCTGCAGGAGATGGTTATTCTTAAAATTAGTCTTATAATCAT
TTACCAACTTAAGGAAATTTACACAACTAAAGTGTTTAATATGCAACATCTAATGCCTAC
TTTTGTGAAGAACACAATGACCCAGTGACAAATTACTGTGCTAATTTAGACTGTTTGAGA
CCACTATGTCCTGATTGTATAGATGCACACTACAAATACCATCTTTAATCATCAACTATT
CCATAAATTGAATCAATAAAAAATATGAAGATTAATTGTTCAAAAAAAGTCGATGCAGCT
ATTCAATCACTCTAAAAAGAAATGAACGACTGTGAACTTAAATATCTAATTGATCCTGAA
CAAGTTATCAATGAAGGAGTAGCAAAGATAAATCATACTAAAGAAAAAGTTCTTCTAATG
GTCCGCAAGTTTTTTGAGATGCAAGAAGATATTTATATTAAAAGAGTGAATGAAAATCTA
CTTCGCTCAGGTGACTTTACTTCAATTTTTGAAAAAATAAATACATTAATTAACGAACTG
GATTAATTGAGATATTCTCTTGAAGGCAATAGCTTCCTCTCTTCAATAAATAGAATATGT
CGCTTAGATTTGATATCGTTGAGAGATAAATTTAAATCAGATATTCATAAAATAGTGTAA
TAGAGAGATTTAGAGCCTGTTTAAGTTCTCATCGATGACCAGAAAGTTATGTAAATTAAA
TAAGATCTTGACTAAACAGTTATAATGGCAAAGTAAAGTGACTAGTAAAATCGCTTTAGT
AACTAGTAAAACATACTTGCAAAGCAATCAAATGTATTTTAACAAGTAAATGATATTCAT
AATCAAAGTTATAGAATTGCCAATGATCTTGCTGGAATTAGCCCATTGAAAGGCACCAAT
TCCAATTTCAACTCTACTGCTCCACCCTTAGCTGGAAAAGGTCCTAGAGAAACTATAGAA
ATTCATACTGCAGATTACTTCGATGAGAGTTGTAAAAGAAAAAATTTACATTTTTTCATC
TACGATCAAGATAACAAAAGTTGCAAGCTAATTTATCTTGATTTGAATGGAAATAAATAG
TTCTAAATAATTAATATTGATGTAGATTTCCCACTACCTGCTTTCCATAAATCAATATCT
CTTCCTGATGGTGAGATATATCTGATTGGAGGTACAAAGCCTGATAAAACAAAGTCTAAT
GCCATATATCGCTATGATCCTTCAAATAAGAAATTAGTTAAAGAAAGTGATGGTATGAAG
GAAGGAAGAAGTAGTTTCGGAGTATGTATATTGAGAAATTGCATTTATGTGATTGGTGGT
ATAGGAAATAATGGTTAATACTTAAATTCATGTGAAAGATATAATCTTAAGTCAAAAAAA
TGGGAAACAGTCAGTTAAGTAAACTAAGCAAGTGCATCATTTTCTTGCACATCTTTTAAC
AACAGGTTTATTTATAAATTTGGAGGAAATCGTGAAGATAAATCACTCTTAAGAACAATT
GAAAAATACGACGTTATGTAAAATAAATGGTATATCATCAATATACAAAATTAAAACACC
GTTCCTTAATTCTTAACTAATTCTTCCTGTGTTTAAATCAATTAAAATGAGATATTTGTA
TTTGGTGGTTACGATGATTAAAACAGTCCTTCTAATGCTTCATTTATTTTGTAAATAGTT
GAGACTAAGGATCCATAATAGTCAGGAGCAATAACCAAAGAAGAAAATTATGTTTACACA
ATTCAAAAAATTAATGCATAACCTCTTCCAATCCCAGAAGGATTTACCAACCCCTAATCA
ATTATTTTAAATAACACTATTTATGCAATTTAAGATTTCCCAAGCAGCAATTCAAATGAG
CTTGATGATAATAAAAGATAGATTTTATAATTTAATGGAAAACAATGGACTCTAATAAGA
GATTCATGA


>TTHERM_00419930(protein)
MFKYSNQEYQKKTLATGDIDPYNYNRAAGDGYSQNQSYNHLPTQGNLHNQSVQYATSNAY
FCEEHNDPVTNYCANLDCLRPLCPDCIDAHYKYHLQSSTIPQIESIKNMKINCSKKVDAA
IQSLQKEMNDCELKYLIDPEQVINEGVAKINHTKEKVLLMVRKFFEMQEDIYIKRVNENL
LRSGDFTSIFEKINTLINELDQLRYSLEGNSFLSSINRICRLDLISLRDKFKSDIHKIVQ
QRDLEPVQVLIDDQKVMQIKQDLDQTVIMAKQSDQQNRFSNQQNILAKQSNVFQQVNDIH
NQSYRIANDLAGISPLKGTNSNFNSTAPPLAGKGPRETIEIHTADYFDESCKRKNLHFFI
YDQDNKSCKLIYLDLNGNKQFQIINIDVDFPLPAFHKSISLPDGEIYLIGGTKPDKTKSN
AIYRYDPSNKKLVKESDGMKEGRSSFGVCILRNCIYVIGGIGNNGQYLNSCERYNLKSKK
WETVSQVNQASASFSCTSFNNRFIYKFGGNREDKSLLRTIEKYDVMQNKWYIINIQNQNT
VPQFLTNSSCVQINQNEIFVFGGYDDQNSPSNASFILQIVETKDPQQSGAITKEENYVYT
IQKINAQPLPIPEGFTNPQSIILNNTIYAIQDFPSSNSNELDDNKRQILQFNGKQWTLIR
DS


>TTHERM_00419930(gene)
ATGTTTAAATATTCAAATTAGGAATACTAAAAAAAAACTTTAGCCACAGGAGACATAGAT
CCTTATAATTACAATAGGGCTGCAGGAGATGGTTATTCTTAAAATTAGTCTTATAATCAT
TTACCAACTTAAGGAAATTTACACAACTAAAGTGTTTAATATGCAACATCTAATGCCTAC
TTTTGTGAAGAACACAATGACCCAGTGACAAATTACTGTGCTAATTTAGACTGTTTGAGA
CCACTATGTCCTGATTGTATAGATGCACACTACAAATACCATCTTTAATCATCAACTATT
CCATAAATTGAATCAATAAAAAATATGAAGATTAATTGTTCAAAAAAAGTCGATGCAGCT
ATTCAATCACTCTAAAAAGAAATGAACGACTGTGAACTTAAATATCTAATTGATCCTGAA
CAAGTTATCAATGAAGGAGTAGCAAAGATAAATCATACTAAAGAAAAAGTTCTTCTAATG
GTAAATTGCTTTGTTTTCATTCTCTTTTGATAGTTATATTTAATGAATATAAATTTTAAA
TTAAAATAATAACTAATTATTTTAAAATAAATTTTTATTAGGTCCGCAAGTTTTTTGAGA
TGCAAGAAGATATTTATATTAAAAGAGTGAATGAAAATCTACTTCGCTCAGGTGACTTTA
CTTCAATTTTTGAAAAAATAAATACATTAATTAACGAACTGGATTAATTGAGATATTCTC
TTGAAGGCAATAGCTTCCTCTCTTCAATAAATAGAATATGTCGCTTAGATTTGATATCGT
TGAGAGATAAATTTAAATCAGATATTCATAAAATAGTGTAATAGAGAGATTTAGAGCCTG
TTTAAGTTCTCATCGATGACCAGAAAGTTATGTAAATTAAATAAGATCTTGACTAAACAG
TTATAATGGCAAAGTAAAGTGACTAGTAAAATCGCTTTAGTAACTAGTAAAACATACTTG
CAAAGCAATCAAATGTATTTTAACAAGGTAACAATTAATGAAATTTATAAAAAATTATAG
TATATTCATCCTATATTAACAATATTTATAGTGTATTTGCTTGTTTTTATATAAAGAACT
GTTTATTTCTTTTATATTACAAACTCTTTTCTTAGATTCTATCTCACTCTTCTCTTTCAT
AAAATTAATTAGTAAATGATATTCATAATCAAAGTTATAGAATTGCCAATGATCTTGCTG
GAATTAGCCCATTGAAAGGCACCAATTCCAATTTCAACTCTACTGCTCCACCCTTAGCTG
GAAAAGGTCCTAGAGAAACTATAGAAATTCATACTGCAGATTACTTCGATGAGAGTTGTA
AAAGAAAAAATTTACATTTTTTCATCTACGATCAAGATAACAAAAGTTGCAAGCTAATTT
ATCTTGATTTGAATGGAAATAAATAGTTCTAAATAATTAATATTGATGTAGATTTCCCAC
TACCTGCTTTCCATAAATCAATATCTCTTCCTGATGGTGAGATATATCTGATTGGAGGTA
CAAAGCCTGATAAAACAAAGTCTAATGCCATATATCGCTATGATCCTTCAAATAAGAAAT
TAGTTAAAGAAAGTGATGGTATGAAGGAAGGAAGAAGTAGTTTCGGAGTATGTATATTGA
GAAATTGCATTTATGTGATTGGTGGTATAGGAAATAATGGTTAATACTTAAATTCATGTG
AAAGATATAATCTTAAGTCAAAAAAATGGGAAACAGTCAGTTAAGTAAACTAAGCAAGTG
CATCATTTTCTTGCACATCTTTTAACAACAGGTTTATTTATAAATTTGGAGGAAATCGTG
AAGATAAATCACTCTTAAGAACAATTGAAAAATACGACGTTATGTAAAATAAATGGTATA
TCATCAATATACAAAATTAAAACACCGTTCCTTAATTCTTAACTAATTCTTCCTGTGTTT
AAATCAATTAAAATGAGATATTTGTATTTGGTGGTTACGATGATTAAAACAGTCCTTCTA
ATGCTTCATTTATTTTGTAAATAGTTGAGACTAAGGATCCATAATAGTCAGGAGCAATAA
CCAAAGAAGAAAATTATGTTTACACAATTCAAAAAATTAATGCATAACCTCTTCCAATCC
CAGAAGGATTTACCAACCCCTAATCAATTATTTTAAATAACACTATTTATGCAATTTAAG
ATTTCCCAAGCAGCAATTCAAATGAGCTTGATGATAATAAAAGATAGATTTTATAATTTA
ATGGAAAACAATGGACTCTAATAAGAGATTCATGA