Identifiers and Description

Gene Model Identifier

TTHERM_00419820

Standard Name

None

Aliases

PreTt07112 | 46.m00167 | 3679.m00017

Description

OTU-like cysteine protease; OTU-like cysteine protease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00419820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11077.19.997093137033517e-262OTU-like cysteine protease (62
2 aa)
OxytrichaContig15818.0.g112.9986068920536807e-84OTU-like cysteine protease
DictyBaseDDB_G02859076.999881090205667e-34DDB_G0285907 on chromosome: 4
position 3810828 to 3812441
Stentor CoeruleusSteCoe_133649.854154686111257e-34
WormBaseWBGene000152494.9976494746363024e-29locus:otub-4 status:Confirme
d UniProt:U4PEY4 protein_i
d:CDH93299.1
SGDYHL013C0.00000005001214305021125OTU2 Protein of unknown functi
on that may interact with ribo
somes, based on co-purificatio
n experiments; member of the o
varian tumor-like (OTU) superf
amily of predicted cysteine pr
oteases; shows cytoplasmic loc
alization

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00419820(coding)
ATGGTATTAAAATCAGAGAAAAATTAAATTGTAAGTGATGATGAAGATGATAACCCTAGC
AGCGGTGAATAAAATTCTGATTCAGATTGCAATGTCGTTGAAGTAGAGCTAGATGAGGAA
TAGGAAAACAACATCAGTCATTAAGTGGATGCTTAAGATTTTAATATGAATTAGAATTAC
AAGATTGATGGTTTAAATTGGGAGGATAAATAGAATAATGATGTTTCTAAGTTTAACCAC
AATCAAGATTCTTAGTTAAATGCAAGTGCATTAAATTAAAAGCAAGATGATGAGGAAGAA
GAAGAAGCAAAATAAGATTTTAGTTAAGAGAAAGAGGGGATTGGAATTAATTCTGAACTT
AAAAAACGATTTTATATTGGTGAGAATATTGATTGCTGTGATACAGTTAATAAGTGGTTA
AATGCAGAAATTGTTTCGCTGCGCCATAACCCAAACGAAATTAGAGTTCATTACAGTGGT
TGGTCATAAAAATATGATGAATGGATTAGCGTTGATAGCAGTCGTATTTTAAAATAATGG
CATCGCTCAAATTCATAAGTAAAGTAAATACCCATTTCTGTAAATAATAGACTTGATGTC
TATCATGAAGAGAGTGGTCAGTGGCTAGAAGCAATTGTTAAGGAAATTTAAAACGAAGAA
GGAACTAAAATAAAAATTCATTATAATGGATACCATAGCAAATATGATGAAGTTGTTAAT
CTAGATGATGAAAGAAGAGTTTAGGAAGTAGGAACCCATTCTTAAGCATTCGGAGCAGCT
AGAACTTAGGCTAGAAATCCTTTGCATTTTACAAAGCGTCTATAAGAATATATTATAAAA
AGAGAAAGAAATTTCATGCAAGAACTTCACTAAAAGAAGAATTTATGTATAAAAGTAGTA
GGTACAGATGGAAATTGTCTCTTCCGTGCTGTAAGCGATTAAATGTATGGTACAGAAGAA
TTTCACAAAGAAATTCGTTCAGTATGTATGGATTATATCTAGATTGAAAGAGCTTTCTTT
GAAAACTACATACATGAAGAGTTTGAAGATTATATAAATAGAAAAAGACAAGATGGTGAA
TGGGGAGATGATATTGAATTAGAAGCATTATCTGAAATATATAATCGCCCCATAGAAGTT
TATGCGTATTCTAGTTAGCCTATGAGAACTTTCCATGAAACAAATTTTAATAACAATGAG
CCTATTCGTTTGAGTTATCATGGTAAATGTCACTACAACTCTGTGAAGAAAAATGGCTTT
TTAAACCTTGGATATCTGCAAATTAGCGACCAGGGAAAACAAGAAGCTGAAGCACTGAAA
AATTCACATTCTCGTCACTAAAGATCTCCTGAATCAAATGCTGAAGTAGCAGAAGCAATT
CAAAACTCCAGAAAAGAATTTGAAATTATAGGAAAAAGAGACATGGAGAGAGCCCTTGAA
GAATCATTACAGCTGTTTGAAGAAAGTGAGAAGGCTAATAACGAGTAATAATTTGTAGAC
ATAGCGATAAAAAGCTCTATAGATGCTTTTATGGAAGCTGAAGAAGAAAAATTAATTATT
GAGCAAGTTAAAAAAGAAACATTGATGCACAATGAGTAATAAGAGAAGCAGCAAACAGAC
GATATAAATATAAAATATGAATAGACCTAAGTAAAAGAACTTGAAGATTTAGAACTGCAA
GAAGCCATAAAATAGAGTTAGGCAAATGCACCTGTAGCTTAAGAAGATCCATTATTAAAC
CCTACAATCGCTAGTGTGGTGGCTATGGGAATTCCTGTAGACTTGGCAATACAAGCCTAC
ACAATAATAGGAGACTTCCCTGATTTGATTATAAATTATATATACGAAAATTATTATTGA


>TTHERM_00419820(protein)
MVLKSEKNQIVSDDEDDNPSSGEQNSDSDCNVVEVELDEEQENNISHQVDAQDFNMNQNY
KIDGLNWEDKQNNDVSKFNHNQDSQLNASALNQKQDDEEEEEAKQDFSQEKEGIGINSEL
KKRFYIGENIDCCDTVNKWLNAEIVSLRHNPNEIRVHYSGWSQKYDEWISVDSSRILKQW
HRSNSQVKQIPISVNNRLDVYHEESGQWLEAIVKEIQNEEGTKIKIHYNGYHSKYDEVVN
LDDERRVQEVGTHSQAFGAARTQARNPLHFTKRLQEYIIKRERNFMQELHQKKNLCIKVV
GTDGNCLFRAVSDQMYGTEEFHKEIRSVCMDYIQIERAFFENYIHEEFEDYINRKRQDGE
WGDDIELEALSEIYNRPIEVYAYSSQPMRTFHETNFNNNEPIRLSYHGKCHYNSVKKNGF
LNLGYLQISDQGKQEAEALKNSHSRHQRSPESNAEVAEAIQNSRKEFEIIGKRDMERALE
ESLQLFEESEKANNEQQFVDIAIKSSIDAFMEAEEEKLIIEQVKKETLMHNEQQEKQQTD
DINIKYEQTQVKELEDLELQEAIKQSQANAPVAQEDPLLNPTIASVVAMGIPVDLAIQAY
TIIGDFPDLIINYIYENYY


>TTHERM_00419820(gene)
ATGGTATTAAAATCAGAGAAAAATTAAATTGTAAGTGATGATGAAGATGATAACCCTAGC
AGCGGTGAATAAAATTCTGATTCAGATTGCAATGTCGTTGAAGTAGAGCTAGATGAGGAA
TAGGAAAACAACATCAGTCATTAAGTGGATGCTTAAGATTTTAATATGAATTAGAATTAC
AAGATTGATGGTTTAAATTGGGAGGATAAATAGAATAATGATGTTTCTAAGTTTAACCAC
AATCAAGATTCTTAGTTAAATGCAAGTGCATTAAATTAAAAGCAAGATGATGAGGAAGAA
GAAGAAGCAAAATAAGATTTTAGTTAAGAGAAAGAGGGGATTGGAATTAATTCTGAACTT
AAAAAACGATTTTATATTGGTGAGAATATTGATTGCTGTGATACAGTTAATAAGTGGTTA
AATGCAGAAATTGTTTCGCTGCGCCATAACCCAAACGAAATTAGAGTTCATTACAGTGGT
TGGTCATAAAAATATGATGAATGGATTAGCGTTGATAGCAGTCGTATTTTAAAATAATGG
CATCGCTCAAATTCATAAGTAAAGTAAATACCCATTTCTGTAAATAATAGACTTGATGTC
TATCATGAAGAGAGTGGTCAGTGGCTAGAAGCAATTGTTAAGGAAATTTAAAACGAAGAA
GGAACTAAAATAAAAATTCATTATAATGGATACCATAGCAAATATGATGAAGTTGTTAAT
CTAGATGATGAAAGAAGAGTTTAGGAAGTAGGAACCCATTCTTAAGCATTCGGAGCAGCT
AGAACTTAGGCTAGAAATCCTTTGCATTTTACAAAGCGTCTATAAGAATATATTATAAAA
AGAGAAAGAAATTTCATGCAAGAACTTCACTAAAAGAAGAATTTATGTATAAAAGTAGTA
GGTACAGATGGAAATTGTCTCTTCCGTGCTGTAAGCGATTAAATGTATGGTACAGAAGAA
TTTCACAAAGAAATTCGTTCAGTATGTATGGATTATATCTAGATTGAAAGAGCTTTCTTT
GAAAACTACATACATGAAGAGTTTGAAGATTATATAAATAGAAAAAGACAAGATGGTGAA
TGGGGAGATGATATTGAATTAGAAGCATTATCTGAAATATATAATCGCCCCATAGAAGTT
TATGCGTATTCTAGTTAGCCTATGAGAACTTTCCATGAAACAAATTTTAATAACAATGAG
CCTATTCGTTTGAGTTATCATGGTAAATGTCACTACAACTCTGTGAAGAAAAATGGCTTT
TTAAACCTTGGATATCTGCAAATTAGCGACCAGGGAAAACAAGAAGCTGAAGCACTGAAA
AATTCACATTCTCGTCACTAAAGATCTCCTGAATCAAATGCTGAAGTAGCAGAAGCAATT
CAAAACTCCAGAAAAGAATTTGAAATTATAGGAAAAAGAGACATGGAGAGAGCCCTTGAA
GAATCATTACAGCTGTTTGAAGAAAGTGAGAAGGCTAATAACGAGTAATAATTTGTAGAC
ATAGCGATAAAAAGCTCTATAGATGCTTTTATGGAAGCTGAAGAAGAAAAATTAATTATT
GAGCAAGTTAAAAAAGAAACATTGATGCACAATGAGTAATAAGAGAAGCAGCAAACAGAC
GATATAAATATAAAATATGAATAGACCTAAGTAAAAGAACTTGAAGATTTAGAACTGCAA
GAAGCCATAAAATAGAGTTAGGCAAATGCACCTGTAGCTTAAGAAGATCCATTATTAAAC
CCTACAATCGCTAGTGTGGTGGCTATGGGAATTCCTGTAGACTTGGCAATACAAGCCTAC
ACAATAATAGGAGACTTCCCTGATTTGATTATAAATTATATATACGAAAATTATTATTGA