Identifiers and Description

Gene Model Identifier

TTHERM_00419710

Standard Name

None

Aliases

PreTt07101 | 46.m00156 | 3679.m00006

Description

kelch motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00419710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11091.19.997093137033517e-262kelch domain-containing protei
n family protein (974 aa)
OxytrichaContig20663.0.g911.9993007828132465e-27Kelch motif
WormBaseWBGene000064930.00000000030007160092483236locus:tag-147 status:Confirm
ed UniProt:Q21854 protein_
id:CAA92005.1
Stentor CoeruleusSteCoe_212940.000000002061153622438558
DictyBaseDDB_G02715000.00006000996057121373keaA on chromosome: 2 position
608312 to 611935

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00419710(coding)
ATGAAGATGAATTAAGTTTAAAGTATTTAAAAAATAGGAGATACTGCAGTTCCATCTCCA
GAAATGAGACCAATTTAGACTTAAGCAAATAATTCAACTATTTTTTAAAGTGCAAAAATA
GCATAGCTCTCTCAATCAGCATAATCAATATAATCTACACCATTTACATAAGTCAGGGAT
ATATCTCCGCTTACTCATAAACAATTGAATGCCCTATCGCCTAGCAAATCAACTTTATCT
CAAGGCCAGAAGAAAAGAAATCATAAAATACCATGCCCTGCACATTAGGAATTTGACATA
TCTAACATGTGCACGGCAGAAGGTTGCTTAGAGCCACTTTGTGCTGAATGCATTCGAGTC
CATACATAGCTTCACAATAATGAAGGAACATCTTCTAATATTGACACAATATTTAATAAA
AGAGATTAGTGTATTGAAATACTGAAAGAGTAAACTAATCTCTTCAGCCAAGAAATTCAA
GTGCTCGGATAAATTGGAGATTCTACAAGAGACAATTTATTAAAATAATCTTTAGAGAAA
ATTTAAATAGCAAAAGAAAAAGTCCTTTTTGTAGTGGAGCAATACTTTAAAGATATTTAA
GAACATGTGCAATAAAAAATAGTTTATTCAAAACAGAGCACAACAGTTGATAAATAGAAA
AACTTAGAATTAAAATTACAGTCAATAATTTAAGATATAGCAAAGATGGAAGATTTATTA
AACTCTGAAGATTTCATAAAAGCAATAATCTAAATATTATCAGGTGAGTATGACCACAAT
TATGAAAAAATTTAGCAAGAAATCAATGAAGTTGTTGAAAAAAGCGGATCAGAATTATTT
GAAGTAGAATTTGATGAATCAAAAATGTACTCTTTGAATATTGAAATATAAAAATTGATC
TTTTTAAAACCTCATAACATGGATGGAGTGATCAATAAAACTTTGGAGATAAGTAAGGCT
GATGTTTTTTAAAGTAAACACTAATCGCCTTTAAAAAAGCATAACTAAACTGTTCTATCA
ACTATTGTCAGTCATTAACAAAGAAATAATTTTTCTTCTAACTAAAAGTTAAATTCTTAA
TCATTTTTGTAAGTTGGAAACCATGTCTCACAAGCTAATGAAAATATAAACAGATAATCT
CTCTAGAATATAGAATCGTTAAATGATTTAAATAAACCAAAAACATTAATTTCCTAAAGA
CCACCCTAATCATAGTAATTATAAAAAAGTATAAATTAAGCTCTTAGCAATTCATAAATA
TCCAAATCAAGTAATATTGGTCTAGATTAATTTATGCATTTACCTAAAAGTTAACGCTAA
TAGCAATAGTAAATGTAAAATGGAAATCTAAGAGAAGAATAAATTTAATCTAGACAGCCA
TACATTTCTTCAAATCAGCCAAGTTTGAATTTAAGCAGAGATTCAAGTCCGAATAGAAAT
AGCGTAAAAGCTTAAGATTAAGTTGGACTTAGAGGTTCTAGATCAATTTCAAGCAACATA
CAATATGAAGGATAATAGAAAAAAATGTATACATTTAATGAAGTAACAACGTTTGGATAA
TAAACAGATAGAGAAATATCATAGTAATAATAATAATAATAATCAATAAATAATTCCAAT
TCAGTCAATTCTATGCGTAAGAACAACCATATAATAAGAAGTTTATAAAATCCATAAAAC
ATTTACTAAGAACCTTAAAGAAATTTTGTCTCTAGCAATTCTCAAGAAAAATATACCCCC
TATACTACTTCAAATCCCTCAAGCTAAAGACCATCTGTTTCGCAGCATGGAGATGAGCGA
ATTTCATAATCTCAAAATATAGAAAATAGCTAGCTTATGAGCTATCCATAAATACTATTA
GAATAAGCAGACTACTTCTCACCTTAAACTTCAAGAAAATTTCTTCATTTCTTCCAAGAT
AATTCTAAAATATTTCATTATTTAGATCTTGAAACTCTTAGCAAAGATTCTTAAACACAG
CAATTTTAACAATAAATTTTAAATATTTAATTCAAAATTCCTATGTACCATAGAAGTGTT
ATGACACCATTTGGGGATACTTATATTACTGGAGGTGTAGATGTTAATTAAAAAAGTTAC
GTACTTAATACATGTTATAAGTTAAACTATAGATAAGCTACACTTGAACCTATCAGTTCC
ATGTATTATCCTAGATCCAATCATGGTATTGCATTTTGTGAAGGTTATATTTATGTTTGT
GGAGGCTCTACAAATCAGGATAATACTTGCTTAGATAAATGCGAAAGATTTGATGTAGAA
ATAGGAAGGTGGGAGTAAATAAGCAGCTTAAATTAAAAATGTAGTGGCTGCTCTCTGAGC
TAATTCTCTAATAGATTTTTATTTAAATTTGGTGGAAATACTGACATATTTACATTAAGC
AATACTATAGAGAGATATGATATTTAGTTAAATGAATGGAAAATAATACCTTTTAATATA
ATTCCTAATCATATAACTATGAAGTTACCAAGTTTCTGTGGATCTTGCTAAGTAAATAAA
GATGAAATAATTTTGCTAGGAGGATCTAATCATAGTAATAAGCTGTAGAACGTATTTTTA
ATCAGAATGTATAGCGAAGAATGTGATGTGATCTTATTAAAACCTTTGCCTAGAGCAGGT
ACATTTTGGCAAAACCCTATTGTCCTTGGAGGAGTAATTTTTAGCTTGCAAAATATAATT
ATGGATAAATCTCCTGACCATTGTTACTTTGGTAAGAAGCGAATATTGGCTTTTAACTCT
TAAATTTGGAAACAAATTGGCTCTGATGAAATAGATTACTACAACTCTTCAAACTCTGCA
AATATGGTTTCATCAAATATTAATATAAATTAGAACTAATCATATATATTGGATAATAGT
TATAGAAAATAAACAGCTTCGAAAAGCCCCTACAGAGTAGGCTAGAGTTTAACTACTTCT
AATAAGCTAAAAAAAGTATTTTATGATTGA


>TTHERM_00419710(protein)
MKMNQVQSIQKIGDTAVPSPEMRPIQTQANNSTIFQSAKIAQLSQSAQSIQSTPFTQVRD
ISPLTHKQLNALSPSKSTLSQGQKKRNHKIPCPAHQEFDISNMCTAEGCLEPLCAECIRV
HTQLHNNEGTSSNIDTIFNKRDQCIEILKEQTNLFSQEIQVLGQIGDSTRDNLLKQSLEK
IQIAKEKVLFVVEQYFKDIQEHVQQKIVYSKQSTTVDKQKNLELKLQSIIQDIAKMEDLL
NSEDFIKAIIQILSGEYDHNYEKIQQEINEVVEKSGSELFEVEFDESKMYSLNIEIQKLI
FLKPHNMDGVINKTLEISKADVFQSKHQSPLKKHNQTVLSTIVSHQQRNNFSSNQKLNSQ
SFLQVGNHVSQANENINRQSLQNIESLNDLNKPKTLISQRPPQSQQLQKSINQALSNSQI
SKSSNIGLDQFMHLPKSQRQQQQQMQNGNLREEQIQSRQPYISSNQPSLNLSRDSSPNRN
SVKAQDQVGLRGSRSISSNIQYEGQQKKMYTFNEVTTFGQQTDREISQQQQQQQSINNSN
SVNSMRKNNHIIRSLQNPQNIYQEPQRNFVSSNSQEKYTPYTTSNPSSQRPSVSQHGDER
ISQSQNIENSQLMSYPQILLEQADYFSPQTSRKFLHFFQDNSKIFHYLDLETLSKDSQTQ
QFQQQILNIQFKIPMYHRSVMTPFGDTYITGGVDVNQKSYVLNTCYKLNYRQATLEPISS
MYYPRSNHGIAFCEGYIYVCGGSTNQDNTCLDKCERFDVEIGRWEQISSLNQKCSGCSLS
QFSNRFLFKFGGNTDIFTLSNTIERYDIQLNEWKIIPFNIIPNHITMKLPSFCGSCQVNK
DEIILLGGSNHSNKLQNVFLIRMYSEECDVILLKPLPRAGTFWQNPIVLGGVIFSLQNII
MDKSPDHCYFGKKRILAFNSQIWKQIGSDEIDYYNSSNSANMVSSNININQNQSYILDNS
YRKQTASKSPYRVGQSLTTSNKLKKVFYD


>TTHERM_00419710(gene)
ATGAAGATGAATTAAGTTTAAAGTATTTAAAAAATAGGAGATACTGCAGTTCCATCTCCA
GAAATGAGACCAATTTAGACTTAAGCAAATAATTCAACTATTTTTTAAAGTGCAAAAATA
GCATAGCTCTCTCAATCAGCATAATCAATATAATCTACACCATTTACATAAGTCAGGGAT
ATATCTCCGCTTACTCATAAACAATTGAATGCCCTATCGCCTAGCAAATCAACTTTATCT
CAAGGCCAGAAGAAAAGAAATCATAAAATACCATGCCCTGCACATTAGGAATTTGACATA
TCTAACATGTGCACGGCAGAAGGTTGCTTAGAGCCACTTTGTGCTGAATGCATTCGAGTC
CATACATAGCTTCACAATAATGAAGGAACATCTTCTAATATTGACACAATATTTAATAAA
AGAGATTAGTGTATTGAAATACTGAAAGAGTAAACTAATCTCTTCAGCCAAGAAATTCAA
GTGCTCGGATAAATTGGAGATTCTACAAGAGACAATTTATTAAAATAATCTTTAGAGAAA
ATTTAAATAGCAAAAGAAAAAGTCCTTTTTGTAGTGGAGCAATACTTTAAAGATATTTAA
GAACATGTGCAATAAAAAATAGTTTATTCAAAACAGAGCACAACAGTTGATAAATAGAAA
AACTTAGAATTAAAATTACAGTCAATAATTTAAGATATAGCAAAGATGGAAGATTTATTA
AACTCTGAAGATTTCATAAAAGCAATAATCTAAGTAAGAAATAGATCAATCAATCAATTA
ATAAATTAATTAAATTTGTTATTCTGATTGAATAAGCTTATTATGGAATATTAATTTATT
TTTCATTTAAAATAATAAAATAGATATTATCAGGTGAGTATGACCACAATTATGAAAAAA
TTTAGCAAGAAATCAATGAAGTTGTTGAAAAAAGCGGATCAGAATTATTTGAAGTAGAAT
TTGATGAATCAAAAATGTACTCTTTGAATATTGAAATATAAAAATTGATCTTTTTAAAAC
CTCATAACATGGATGGAGTGATCAATAAAACTTTGGAGATAAGTAAGGCTGATGTTTTTT
AAAGTAAACACTAATCGCCTTTAAAAAAGCATAACTAAACTGTTCTATCAACTATTGTCA
GTCATTAACAAAGAAATAATTTTTCTTCTAACTAAAAGTTAAATTCTTAATCATTTTTGT
AAGTTGGAAACCATGTCTCACAAGCTAATGAAAATATAAACAGATAATCTCTCTAGAATA
TAGAATCGTTAAATGATTTAAATAAACCAAAAACATTAATTTCCTAAAGACCACCCTAAT
CATAGTAATTATAAAAAAGTATAAATTAAGCTCTTAGCAATTCATAAATATCCAAATCAA
GTAATATTGGTCTAGATTAATTTATGCATTTACCTAAAAGTTAACGCTAATAGCAATAGT
AAATGTAAAATGGAAATCTAAGAGAAGAATAAATTTAATCTAGACAGCCATACATTTCTT
CAAATCAGCCAAGTTTGAATTTAAGCAGAGATTCAAGTCCGAATAGAAATAGCGTAAAAG
CTTAAGATTAAGTTGGACTTAGAGGTTCTAGATCAATTTCAAGCAACATACAATATGAAG
GATAATAGAAAAAAATGTATACATTTAATGAAGTAACAACGTTTGGATAATAAACAGATA
GAGAAATATCATAGTAATAATAATAATAATAATCAATAAATAATTCCAATTCAGTCAATT
CTATGCGTAAGAACAACCATATAATAAGAAGTTTATAAAATCCATAAAACATTTACTAAG
AACCTTAAAGAAATTTTGTCTCTAGCAATTCTCGTAAATTAAGTTTACTTTTAAAAAAAT
TTTTATTTATTTATTTAAAAAAATAACAGAAGAAAAATATACCCCCTATACTACTTCAAA
TCCCTCAAGCTAAAGACCATCTGTTTCGCAGCATGGAGATGAGCGAATTTCATAATCTCA
AAATATAGAAAATAGCTAGCTTATGAGCTATCCATAAATACTATTAGAATAAGCAGACTA
CTTCTCACCTTAAACTTCAAGAAAATTTCTTCATTTCTTCCAAGATAATTCTAAAATATT
TCATTATTTAGATCTTGAAACTCTTAGCAAAGATTCTTAAACACAGCAATTTTAACAATA
AATTTTAAATATTTAATTCAAAATTCCTATGTACCATAGAAGTGTTATGACACCATTTGG
GGATACTTATATTACTGGAGGTGTAGATGTTAATTAAAAAAGTTACGTACTTAATACATG
TTATAAGTTAAACTATAGATAAGCTACACTTGAACCTATCAGTTCCATGTATTATCCTAG
ATCCAATCATGGTATTGCATTTTGTGAAGGTTATATTTATGTTTGTGGAGGCTCTACAAA
TCAGGATAATACTTGCTTAGATAAATGCGAAAGGTAAATAAAAATAATTTTTAAGAAAAT
ATTTGTAAATTTAAAGAGTTAAATTTAAAAATTTTTAAATCAAAATAAGTTGATTAAAAA
AAATATTTAATATTAGATTTGATGTAGAAATAGGAAGGTGGGAGTAAATAAGCAGCTTAA
ATTAAAAATGTAGTGGCTGCTCTCTGAGCTAATTCTCTAATAGATTTTTATTTAAATTTG
GTGGAAATACTGACATATTTACATTAAGCAATACTATAGAGAGATATGATATTTAGTTAA
ATGAATGGAAAATAATACCTTTTAATATAATTCCTAATCATATAACTATGAAGTTACCAA
GTTTCTGTGGATCTTGCTAAGTAAATAAAGATGAAATAATTTTGCTAGGAGGATCTAATC
ATAGTAATAAGCTGTAGAACGTATTTTTAATCAGAATGTATAGCGAAGAATGTGATGTGA
TCTTATTAAAACCTTTGCCTAGAGCAGGTACATTTTGGCAAAACCCTATTGTCCTTGGAG
GAGTAATTTTTAGCTTGCAAAATATAATTATGGATAAATCTCCTGACCATTGTTACTTTG
GTAAGAAGCGAATATTGGCTTTTAACTCTTAAATTTGGAAACAAATTGGCTCTGATGAAA
TAGATTACTACAACTCTTCAAACTCTGCAAATATGGTTTCATCAAATATTAATATAAATT
AGAACTAATCATATATATTGGATAATAGTTATAGAAAATAAACAGCTTCGAAAAGCCCCT
ACAGAGTAGGCTAGAGTTTAACTACTTCTAATAAGCTAAAAAAAGTATTTTATGATTGA