Identifiers and Description

Gene Model Identifier

TTHERM_00418590

Standard Name

WASP

Aliases

PreTt13622 | 45.m00267 | 3833.m00813 | WASP

Description

WH1 domain protein; WH1 domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.7%

TetraMine Data

TTHERM_00418590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05938.19.997093137033517e-262WH1 domain-containing protein
(447 aa)
OxytrichaContig15687.0.g181.9999391735788327e-19WH1 domain
DictyBaseDDB_G02938340.00000000000009996062864481225wasA on chromosome: 6 position
3376698 to 3378105
SGDYOR181W0.00000000009998509410508463LAS17 Actin assembly factor, a
ctivates the Arp2/3 protein co
mplex that nucleates branched
actin filaments; localizes wit
h the Arp2/3 complex to actin
patches; homolog of the human
Wiskott-Aldrich syndrome prote
in (WASP)
Stentor CoeruleusSteCoe_57080.00000614421235332821

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00418590(coding)
ATGTCATAAATTTAGCAATAAAATAGTAGAGCAGTACCAGAAGAAGTTAAGAAACTTCTT
CAGTAAGTTATTGGAAACAAATAAACCATCATGAGTATAGCTATTGCAAGAATATTCACA
GCTAGATCAGAGGGAGAATGGATTTACTCAAATCTTTAGGGAATACTTTGTCTTGTTTGG
GACAGAGAAAAAGATAATACACCTTTTTTAAGATTATTCGATATAGAAACATTTGATTTG
CTTTTTGAAGCAGAAATGTATATAGATTTCCATTTAAGCTACGCATCTGTCAATCCTACT
TTTTACATGTTTGAATATATGAATGCCTTTATTGGTTTATAATTTATTTCTGACTCGGAG
GCAAGTTAATTTAGTTTAAAAGTAATGACTTAATCGCTTAAAGATGTCAAACCAGAATAG
AATATCTAACAACAGCAATAGCCTAAAGAAAAAAAGAAAGAAGAAAAAGAGGGTCTGTTT
GGTTTTCGTAAAGGATTAAAAAAGATTGTCAGCAATTTATTTTAAAAAGATGGCAAACAT
AATTAAGATGCTGAAAACATTGAAATTTCTAAGCCTATAAGCTTTTAAAAGGTTACTTCT
TTGCAATTTAATATTAAAACAAATTAATTTGACTTCTCTAACTTAAACGATGAGTGGAAA
TAAATCTTTTCACGTGCAGGTATTCAGTAGTCAGACCTTTCAAACGAAGAATTGGCTCCT
ATAATTTTTGAATCAGTTATTCGCTTTTAATCTCACTATGAAAACTAAATAGAAAACAAG
CAAAAGGAATCTTAATAATAACAATAATAACCAAATCAATAAAGCAACAATAATACTTAG
TCAACAAAATAATAAAACTAAACTATAAATGAAGCTTCATAAAGCATTCCAGTAGCACCA
TAAATTAATATGAATATACCACCTCCACCACCTATGAATTTAAATATTCCACCTCCACCT
CCAATTAATATACCATCAGCTCCTGTCTTAGATTTTAATTCCTCTATAAAGAACAATAAT
ATCCCAGCTGCTCCTGTTATTCCAAATATAAATGATGATAAAAATCGTATAAGCATTTCG
ACACAAAATAAAAACTTTGATTCTTCTCAAGTAATGAACAAATCATCGCTTTTAGACTAA
ATTAAAACTGGTAACTTTTAACTAAAACATGTAGAGGTAAACAAAAAAGATAATAAAGCT
AATCTCGATATATCTTAAATGGATGATTAAGCATAAGAAAATCTTACACTATATTTATCA
AAATGTATTGCTGAGAGAAGAAAATAAATTAGAAAGCACAAATATTCTTCATCTGAAGAA
AGTAACGATAGTGATGATGATGACGATTGA


>TTHERM_00418590(protein)
MSQIQQQNSRAVPEEVKKLLQQVIGNKQTIMSIAIARIFTARSEGEWIYSNLQGILCLVW
DREKDNTPFLRLFDIETFDLLFEAEMYIDFHLSYASVNPTFYMFEYMNAFIGLQFISDSE
ASQFSLKVMTQSLKDVKPEQNIQQQQQPKEKKKEEKEGLFGFRKGLKKIVSNLFQKDGKH
NQDAENIEISKPISFQKVTSLQFNIKTNQFDFSNLNDEWKQIFSRAGIQQSDLSNEELAP
IIFESVIRFQSHYENQIENKQKESQQQQQQPNQQSNNNTQSTKQQNQTINEASQSIPVAP
QINMNIPPPPPMNLNIPPPPPINIPSAPVLDFNSSIKNNNIPAAPVIPNINDDKNRISIS
TQNKNFDSSQVMNKSSLLDQIKTGNFQLKHVEVNKKDNKANLDISQMDDQAQENLTLYLS
KCIAERRKQIRKHKYSSSEESNDSDDDDD


>TTHERM_00418590(gene)
ATGTCATAAATTTAGCAATAAAATAGTAGAGCAGTACCAGAAGAAGTTAAGAAACTTCTT
CAGTAAGTTATTGGAAACAAATAAACCATCATGAGTATAGCTATTGCAAGAATATTCACA
GCTAGATCAGAGGGAGAATGGATTTACTCAAATCTTTAGGGAATACTTTGTCTTGTTTGG
GACAGAGAAAAAGATAATACACCTTTTTTAAGATTATTCGATATAGAAACATTTGATTTG
CTTTTTGAAGCAGAAATGTATATAGATTTCCATTTAAGCTACGCATCTGTCAATCCTACT
TTTTACATGTTTGAATATATGAATGCCTTTATTGGTTTATAATTTATTTCTGACTCGGAG
GCAAGTTAATTTAGTTTAAAAGTAATGACTTAATCGCTTAAAGATGTCAAACCAGAATAG
AATATCTAACAACAGCAATAGCCTAAAGAAAAAAAGAAAGAAGAAAAAGAGGGTCTGTTT
GGTTTTCGTAAAGGATTAAAAAAGATTGTCAGCAATTTATTTTAAAAAGATGGCAAACAT
AATTAAGATGCTGAAAACATTGAAATTTCTAAGCCTATAAGCTTTTAAAAGGTTACTTCT
TTGCAATTTAATATTAAAACAAATTAATTTGACTTCTCTAACTTAAACGATGAGTGGAAA
TAAATCTTTTCACGTGCAGGTATTCAGTAGTCAGACCTTTCAAACGAAGAATTGGCTCCT
ATAATTTTTGAATCAGTTATTCGCTTTTAATCTCACTATGAAAACTAAATAGAAAACAAG
CAAAAGGAATCTTAATAATAACAATAATAACCAAATCAATAAAGCAACAATAATACTTAG
TCAACAAAATAATAAAACTAAACTATAAATGAAGCTTCATAAAGCATTCCAGTAGCACCA
TAAATTAATATGAATATACCACCTCCACCACCTATGAATTTAAATATTCCACCTCCACCT
CCAATTAATATACCATCAGCTCCTGTCTTAGATTTTAATTCCTCTATAAAGAACAATAAT
ATCCCAGCTGCTCCTGTTATTCCAAATATAAATGATGATAAAAATCGTATAAGCATTTCG
ACACAAAATGTAAATCTTTTAATATTGATTAATATTTAACTTTAAATTAAATTTATTTAA
AATATAAATAGAAAAACTTTGATTCTTCTCAAGTAATGAACAAATCATCGCTTTTAGACT
AAATTAAAACTGGTAACTTTTAACTAAAACATGTAGAGGTAAACAAAAAAGATAATAAAG
CTAATCTCGATATATCTTAAATGGATGATTAAGCATAAGAAAATCTTACACTATATTTAT
CAAAATGTATTGCTGAGAGAAGAAAATAAATTAGAAAGCACAAATATTCTTCATCTGAAG
AAAGTAACGATAGTGATGATGATGACGATTGA