Identifiers and Description

Gene Model Identifier

TTHERM_00418560

Standard Name

None

Aliases

PreTt13619 | 45.m00264 | 3833.m00810

Description

U1 zinc finger protein; U1 zinc finger family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06220 ) U1 zinc finger
  • ( PF07271 ) Cytadhesin P30/P32
  • ( PF00096 ) Zinc finger, C2H2 type
  • ( TIGR02427 ) 3-oxoadipate enol-lactonase
  • ( PF00561 ) hydrolase, alpha/beta fold family
  • ( TIGR01619 ) conserved hypothetical protein TIGR01619

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00418560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_151530
Tetrahymena borealisEI9_19687.15.0001954228079815e-129hypothetical protein (394 aa)
WormBaseWBGene000193290.00003998524687536623locus:ceeh-1 status:Confirme
d UniProt:G5EBI4 protein_i
d:CCD61875.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00418560(coding)
ATGAAAGGAAACAAATACTTTATTTATGATAAAGACTAAAGAAATCAAGAAATAATTCAA
ACTTAGTCAAAAATAATTAACTAACTCTGTGATAAGAACAAATAAACTTTTGATAAGTAT
GTAAGTTAGCAGCTCTTTTAAATTGAAAACAATCTTAAAAATCAAGAAAAATAAGAAGTG
GTTTAAATGAATTTTGATGATGGTAGATATGTTTTTTACAGAGATAACTATAAAAATCAT
AAGCATTTTGAATTTTAAAACAAGTGTATTATCCTTATTTAAGGTATCCCTGGTGGTGTA
TATTATTATTCGAGATTAGAGAAGGGAATAGGGAATAATTTTTGCAGGGTAATCAATTTT
TATGTACCTGGACTTGATAAGAAGGATGAGCGAAGAGGAAATTATAGAGGAACATTAGAT
GGTTTAATATAACTAATTAATGATTTTATGGAGAATTTAAAGATTGAAAAGGCTATATTC
GTTATGCATTCAGTGGGTGGATTAATAGGAAAATCTTTTGCTGCTTAAAAGCCTTAAAGG
GTTGAGGCTCTAGTGTAAATAGCTACAGTGCCTATAACTAAATGGAATGGAATCAGATTA
TGTGAGTAAATAGAATAAAAATTCTATTCATTAAATGACTCTATTACCTCAGAAGTATTT
TTCAGCAATCAATTCAGAGAATAATTTAAAGTCGTTCATGATCAAAGCAAGTAAGTTTTA
GATAATTTATCAAAATAAGAGAAGGAATTACTTGGTCCTATTCTATAATTTAATTTTCTC
GACACCTTAAATTTTTTGAAGCTCAGATTAAGTTATCCTGGTAGAATCTTTGAAGTACTT
CATAGAATGAGATAAGTAGATAAAAAAATTCCAAGAATGTTCGTTTATTCTTCTTAAGAT
TAATTAATGCAGTAAAGTCTATAGGAAGAAGAAATATTTTTGTTTGTAGTTGGTCAAGAT
GCTGTAAAAAGAAGAATAACCAAAAAAATTGATAATTAAATGAATCTAGATGAACAAAAC
TTCAGTGCAAACTATATCTTTCGGTATGACGATGCAACTCATATTGTTTAGCATGAGAAA
GGAACCGAGATAGGAATTCTCATCAAGCATTTTGTATCTTAACTACAGTTAACTGAAATT
ATAATTGAAAAATCTAAATTATGA


>TTHERM_00418560(protein)
MKGNKYFIYDKDQRNQEIIQTQSKIINQLCDKNKQTFDKYVSQQLFQIENNLKNQEKQEV
VQMNFDDGRYVFYRDNYKNHKHFEFQNKCIILIQGIPGGVYYYSRLEKGIGNNFCRVINF
YVPGLDKKDERRGNYRGTLDGLIQLINDFMENLKIEKAIFVMHSVGGLIGKSFAAQKPQR
VEALVQIATVPITKWNGIRLCEQIEQKFYSLNDSITSEVFFSNQFREQFKVVHDQSKQVL
DNLSKQEKELLGPILQFNFLDTLNFLKLRLSYPGRIFEVLHRMRQVDKKIPRMFVYSSQD
QLMQQSLQEEEIFLFVVGQDAVKRRITKKIDNQMNLDEQNFSANYIFRYDDATHIVQHEK
GTEIGILIKHFVSQLQLTEIIIEKSKL


>TTHERM_00418560(gene)
ATGAAAGGAAACAAATACTTTATTTATGATAAAGACTAAAGAAATCAAGAAATAATTCAA
ACTTAGTCAAAAATAATTAACTAACTCTGTGATAAGAACAAATAAACTTTTGATAAGTAT
GTAAGTTAGCAGCTCTTTTAAATTGAAAACAATCTTAAAAATCAAGAAAAATAAGAAGTG
GTTTAAATGAATTTTGATGATGGTAGATATGTTTTTTACAGAGATAACTATAAAAATCAT
AAGCATTTTGAATTTTAAAACAAGTGTATTATCCTTATTTAAGGTATCCCTGGTGGTGTA
TATTATTATTCGAGATTAGAGAAGGGAATAGGGAATAATTTTTGCAGGGTAATCAATTTT
TATGTACCTGGACTTGATAAGAAGGATGAGCGAAGAGGAAATTATAGAGGAACATTAGAT
GGTTTAATATAACTAATTAATGATTTTATGGAGAATTTAAAGATTGAAAAGGCTATATTC
GTTATGCATTCAGTGGGTGGATTAATAGGAAAATCTTTTGCTGCTTAAAAGCCTTAAAGG
GTTGAGGCTCTAGTGTAAATAGCTACAGTGCCTATAACTAAATGGAATGGAATCAGATTA
TGTGAGTAAATAGAATAAAAATTCTATTCATTAAATGACTCTATTACCTCAGAAGTATTT
TTCAGCAATCAATTCAGAGAATAATTTAAAGTCGTTCATGATCAAAGCAAGTAAGTTTTA
GATAATTTATCAAAATAAGAGAAGGAATTACTTGGTCCTATTCTATAATTTAATTTTCTC
GACACCTTAAATTTTTTGAAGCTCAGATTAAGTTATCCTGGTAGAATCTTTGAAGTACTT
CATAGAATGAGATAAGTAGATAAAAAAATTCCAAGAATGTTCGTTTATTCTTCTTAAGAT
TAATTAATGCAGTAAAGTCTATAGGAAGAAGAAATATTTTTGTTTGTAGTTGGTCAAGAT
GCTGTAAAAAGAAGAATAACCAAAAAAATTGATAATTAAATGAATCTAGATGAACAAAAC
TTCAGTGCAAACTATATCTTTCGGTATGACGATGCAACTCATATTGTTTAGCATGAGAAA
GGAACCGAGATAGGAATTCTCATCAAGCATTTTGTATCTTAACTACAGTTAACTGAAATT
ATAATTGAAAAATCTAAATTATGA