Identifiers and Description

Gene Model Identifier

TTHERM_00411610

Standard Name

None

Aliases

PreTt21579 | 44.m00246 | 3714.m00092

Description

Alpha amylase, catalytic domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02456 ) trehalose synthase
  • ( PF09303 ) KCNMB2, ball and chain domain
  • ( TIGR02403 ) alpha,alpha-phosphotrehalase
  • ( PF00128 ) Alpha amylase, catalytic domain
  • ( TIGR02402 ) malto-oligosyltrehalose trehalohydrolase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10352.19.997093137033517e-262hypothetical protein (1639 aa)
OxytrichaContig22780.0.g169.997639769646959e-151Alpha amylase, catalytic domai
n
DictyBaseDDB_G02815471.9995317320402142e-140amyA on chromosome: 3 position
4671220 to 4673075
SGDYJL216C0.00000000002000577768187062IMA5 Alpha-glucosidase with sp
ecificity for isomaltose, malt
ose, and palatinose; member of
the IMA isomaltase family; no
t required for isomaltose util
ization, but Ima5p overexpress
ion allows the ima1 null mutan
t to grow on isomaltose
WormBaseWBGene000002240.000000100009565553302locus:atgp-1 status:Confirme
d UniProt:Q9XVU3 protein_i
d:CAB02316.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00411610(coding)
ATGAGCAAACTCTAATTTGTATTAATTGCTGCACTTCTTCTTGTTGCAGTCTCTGCTAAA
ACCGCTTAGGAATGGAAGACACGTAACATTTATCAAATCATCACTGATAGATTCGCTCTT
GGTGATGGATCTAAGCCATACTGTGATTTAAATAAATAACCCTACTATTGTGGTGGTAAC
TTCAAGGGTATTGAGAACAATCTTGACTACATTCAAGGTATGGGTTTCAATGCTATTTGG
ATCTCTCCTGTTCCTGATAACTACCCCAACTAATTCCATGGTTATGCTGCCAAGAACATG
ACTGAAATAAACAGCCATTTTGGTGGTGCTGATGGTCTTAAATCTCTTATTGATGCATGC
CACAAGAGAGATATCTGGGTTATGATTGATGTTGTTGCTAACCACATGGGTAACACCGAT
TAAAACTACTCTGAAAATATTCCCTTCAACTCTCCTGATCACTATCACTCTTACTGTATT
ATTTCTGATTCAGATTTCGCAACTAAGAATATGTACAACATTCAACACTGCAGACTTGCT
GGGCTTGCCGACCTTAACTAAGAAAATTCTTATGTTAGCAACTATCTTGTTAACTGGATT
AAGGATCTTGTTTAAACCTACAACGTTGATGGTATTAGAATAGACACTGTCCCTGAAGTA
CACCCTGACTTCTGGAAATAATATACTACCTCTGCTGGTGTTTTTGCTACTGGTGAAGTT
TTTGATGGTGATTTTGGATATGTTGCCAGCTACATTCCCTCTGTTGGCTCAGTCTTGAAC
TATCCTTGGTACTTTAACATGAGAGATATCTTCGTTAACCAAAAGGATATGTGGGGAGTT
AGAACCTATTACTAAAATTGGGCTAATTAACACGCTGATCTTTCTATCCTTACTCCTTTC
GTTGATAATCACGATAATCCTCGTTTCTTATCTGATCAAGTCTTCAATAATGGTAAAGAC
AGAAACACTCGTATTCAACTCTTAAAGGGATACACAACTTTCACTCTTACATCTATTGGT
ATTCCTATTCTTTACTACGGTACTGAATAATACTTCTCTGGTAATACTGATCCTTATGAC
CGTGAACCTTTGTGGAACAGCTTAAACACTAACTCTGATATGTACAAATATGTCCAATCT
ATTTTATATGCTAAGAACATCACTAATGCTGGATTATAAGGATAAACTGAAGCTTATTGT
GACCAAGATTTATATGCTTTCTTCAGAGGTAAATTGTTCGTTGGTGTCACTTCTAAGTTT
AATTAAGTTACAAGACAAATTGTTACTCATCCCTTCTCAAATGGTGAAGTTATTTGCAAT
ATTTTCTATCCTACTTAAGATTGCCTTACAATTACTAATAACTCCTTCAACCTTGTTCTT
ATTGGTGGTGAAGCTAAGATCTTTGTTCCTAAATCTCTCCTCTAAAAATCAAGTTAATTT
TTGAGATCTGCTTCTAGTTGA


>TTHERM_00411610(protein)
MSKLQFVLIAALLLVAVSAKTAQEWKTRNIYQIITDRFALGDGSKPYCDLNKQPYYCGGN
FKGIENNLDYIQGMGFNAIWISPVPDNYPNQFHGYAAKNMTEINSHFGGADGLKSLIDAC
HKRDIWVMIDVVANHMGNTDQNYSENIPFNSPDHYHSYCIISDSDFATKNMYNIQHCRLA
GLADLNQENSYVSNYLVNWIKDLVQTYNVDGIRIDTVPEVHPDFWKQYTTSAGVFATGEV
FDGDFGYVASYIPSVGSVLNYPWYFNMRDIFVNQKDMWGVRTYYQNWANQHADLSILTPF
VDNHDNPRFLSDQVFNNGKDRNTRIQLLKGYTTFTLTSIGIPILYYGTEQYFSGNTDPYD
REPLWNSLNTNSDMYKYVQSILYAKNITNAGLQGQTEAYCDQDLYAFFRGKLFVGVTSKF
NQVTRQIVTHPFSNGEVICNIFYPTQDCLTITNNSFNLVLIGGEAKIFVPKSLLQKSSQF
LRSASS


>TTHERM_00411610(gene)
TTAAATCAATTTCTAATAATACGAAAAAATATCTCAGATAAAAAATAAGGTGAAGAACTA
TAATTAATATATTTTCATCACTCCTATATGAGCAAACTCTAATTTGTATTAATTGCTGCA
CTTCTTCTTGTTGCAGTCTCTGCTAAAACCGCTTAGGAATGGAAGACACGTAACATTTAT
CAAATCATCACTGATAGGTAATAAACTTTTATACTTTTTTTATTTTGCGCACAAAAAAAC
GCCTTAATCATCTGTCTATCTGGATTACCATTCGCACTATGCTAGATAAATTCAGACTCC
TAAACTGCAAAATATTCATGAGATACAGGATAAAACGAGATGATTATCGCTAATACAATA
AAATTATTATAACATTTATCTCAATAATTTTATTTGAATATGTAGATTCGCTCTTGGTGA
TGGATCTAAGCCATACTGTGATTTAAATAAATAACCCTACTATTGTGGTGGTAACTTCAA
GGGTATTGAGAACAATCTTGACTACATTCAAGGTAAATTTTTAATATCTTATTTCGTTAG
GGGTATTTAATAAATAATACCTTGCTGCTATTTGATTTAAATTGAGAGATTAATAGGGAA
ATGTTATTTGGTAAATTAACAAATTAATTTGTATATGCTGTCTCTAATATCTATCTAGCT
ACGGCTATATGACTCCAATTAATGATTTATATTCAATATTTGTTTCCTTAACATTTATTT
TTAATTAATTGGTCTTAATTTATATATAGGTATGGGTTTCAATGCTATTTGGATCTCTCC
TGTTCCTGATAACTACCCCAACTAATTCCATGGTTATGCTGCCAAGAACATGACTGAAAT
AAACAGCCATTTTGGTGGTGCTGATGGTCTTAAATCTCTTATTGATGCATGCCACAAGAG
AGGTAATCAGATATTCTTTTATCTAATAAATAAATATGGCCATTAAAATAGTCAAAAAAC
AAAAACTTACTTTGCTTAAAATATTTTTAATAGCAGAAAAAACTTAAAAATGTTTTTTCT
CTTGCAATTACAATTGAAGAATTAATATTTTTTCTTAAATGAAAGAGTAATCTTTTTGTA
CTAAGTTTCTTTCGTCATTATGTTGGCAATTACAATTTAAAATAAATTAGTTCTATGAGT
TGGCATAATTGAAAAATCTTCATATTATCAATAAAAAATAGATAAATTCATGAAAATTTT
TCTTAAAGATAAAATCCAATCTAATTTAATGAAAGTTTTTTTCGATAATCAACATACAAT
TATACTAACAAATAAACTTTTTTTTCTAGAGGAAGACAAATTAAAAATGAAAAAAATTAA
ATATCTATCAGATTAATTTATCAATTTCTTAAGCAAAAAATAAATTTAAAAAAAAAGAAT
ATATTTGAATCATTTTATTTTTCATTTTAATCAAAATTAATATTTTTTATTTTATCAAAA
ATAATCATTTATTAGTTTTTTAATATTATCATTAATTATTTTAATAATTAGATATCTGGG
TTATGATTGATGTTGTTGCTAACCACATGGGTAACACCGATTAAAACTACTCTGAAAATA
TTCCCTTCAACTCTCCTGATCACTATCACTCTTACTGTATTATTTCTGATTCAGATTTCG
CAACTAAGAATATGTACAACATTCAACACTGCAGACTTGCTGGGCTTGCCGACCTTAACT
AAGAAAATTCTTATGTTAGCAACTATCTTGTTAACTGGATTAAGGATCTTGTTTAAACCT
ACAACGTTGATGGTATTAGAATAGGTAACATTTTTTAAATTACATACTTTAAATAAAAAT
AGTACTTTTATTGGAAGATTGAATTGTTAAAGAAATGAAAACTATATTTAACTAATCAAT
TAATAACATGGTAGAATATAAAAAAAAAGAATTATTGCATTATACAATTAAATATATGCT
TGAATATCAGATTTATTATCTTAATTATCTATCATTATATATTAATTTTTTGAGTTTTTT
TAATAAATTAATTCAAGATAAAAAGTTAAAAATAGAAAAGATAATTTGAGATAAATAATT
TAATGGCAATCTTCTATCAAAATTAATAAAAAAAATAGTTTGAAAGAGTTAAAATTAAAA
GTCAGATTAATTTTATCTATTCAAGTAAGCAAATTATTGTAAAGAGAAACAAATAATTAC
TTACAACTTAATTTTTTTAATTTTTAATAATTTAATATTTAGTAACTCAAATAATTAATT
ATAAATTACTCTAAACATAACAATCTTCCAATATAAACTAAATATAAATAAACTTGAAAA
ATTACTACTGATAATTTATTCAGTTATTTATTCGAAATTTATAATCTTGTTTGTACAAAT
AAATATTTATAAATTAATATTTATATAAATAGACACTGTCCCTGAAGTACACCCTGACTT
CTGGAAATAATATACTACCTCTGCTGGTGTTTTTGCTACTGGTGAAGTTTTTGATGGTGA
TTTTGGATATGTTGCCAGCTACATTCCCTCTGTTGGCTCAGTCTTGAACTATCCTTGGTA
CTTTAACATGAGAGATATCTTCGTTAACCAAAAGGATATGTGGGGAGTTAGAACCTATTA
CTAAAATTGGGCTAATTAACACGCTGATCTTTCTATCCTTACTCCTTTCGTTGATAATCA
CGATAATCCTCGTTTCTTATCTGATCAAGTCTTCAATAATGGTAAAGACAGAAACACTCG
TATTCAACTCTTAAAGGGATACACAACTTTCACTCTTACATCTATTGGTATTCCTATTCT
TTACTACGGTACTGAATAATACTTCTCTGGTAATACTGATCCTTATGACCGTGAACCTTT
GTGGAACAGCTTAAACACTAACTCTGATATGTAATATTTTAAGTTCAATTTAAATTAGTT
TATTTATTTTTTTTTTTATATTTAATGAGGTACAAATATGTCCAATCTATTTTATATGCT
AAGAACATCACTAATGCTGGATTATAAGGATAAACTGAAGCTTATTGTGACCAAGATTTA
TATGCTTTCTTCAGAGGTAAATTGTTCGTTGGTGTCACTTCTAAGTTTAATTAAGTTACA
AGACAAATTGTTACTCATCCCTTCTCAAATGGTGAAGTTATTTGCAATATTTTCTATCCT
ACTTAAGATTGCCTTACAATTACTAATAACTCCTTCAACCTTGTTCTTATTGGTGGTGAA
GCTAAGATCTTTGTTCCTAAATCTCTCCTCTAAAAATCAAGTTAATTTTTGAGATCTGCT
TCTAGTTGA