Identifiers and Description

Gene Model Identifier

TTHERM_00400821

Standard Name

None

Aliases

3713.m01020

Description

rad25/xp-B DNA repair helicase; DNA repair helicase rad25

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( TIGR00413 ) rare lipoprotein A
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR00068 ) lactoylglutathione lyase
  • ( TIGR00603 ) DNA repair helicase rad25
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( TIGR00188 ) ribonuclease P protein component
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF08674 ) Acetylcholinesterase tetramerisation domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00400821

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13998.19.997093137033517e-262rad25/xp-B DNA repair helicase
(689 aa)
SGDYIL143C3.0014466598835893e-101SSL2 Component of the holoenzy
me form of RNA polymerase tran
scription factor TFIIH, has DN
A-dependent ATPase/helicase ac
tivity and is required, with R
ad3p, for unwinding promoter D
NA; involved in DNA repair; ho
molog of human ERCC3
WormBaseWBGene000134419.999987414410742e-95status:Partially_confirmed U
niProt:Q95PZ4 protein_id:CAC
70144.1
OxytrichaContig12817.0.g891.9991716194688635e-85Type III restriction enzyme, r
es subunit
DictyBaseDDB_G02787291.0004671766404936e-76repB on chromosome: 3 position
1389108 to 1391685
Stentor CoeruleusSteCoe_90562.506567475899953e-46

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00400821(protein)
MSVPVQYIADYSNTPEARLKKNHQKYCLYLKPADRDYSSSFEIQENRGFFPETLYIFVEA
FHEKYKEVYEFLIKIAEPVNKPNFIHVYKITLFSMYTAMSLNLNAEKIIESLMQYSKNEV
IPKSFIEFIENKTKKAGSAYLYMIKKNYYLKIHQEFLEKIIRIDEEPYKSIIEMEQNPPQ
QLLQTQEESRVWNFKFYRIKQKHNLFQITEKIIKEGISLINEYHDDKESQNDLSSNVQIP
YKKLDIELRQITQPRIYQQKALKNIFVCEKPRSATIVLPCGAGKTLLGIIVTEKIKGNTI
VICDIDTATKQWKNEFIRWTTVKPDRIKIYTGKTKNLQEKQTKPFILITTFKQLSSIIKS
NKLQKEKRQDMDTSSKYETKMDHYIQEEMEWDLCIADETQYSAASTYKKIFEEFNFKLKI
GLTATPYREDNKIDDLFHVIGPKLYEANISELIQDSYLAKPYCVVFRCKMHECCEDFMKD
RKFKNKPSLQSGNPEKFKLLYYLIKFHESRKDKILVFCDQIPVLKYYSQKMGYPAIYGEV
GLLEKLVWLDLFRKGEINTLFLSRVGDTALDLPIANVCIQIGFQFGSRRQEVQRLGRIMR
RKEGQKGEYNAFFYTIVSKNTEQAQFYYRRQKSLMDLGINFEVIDIDEQNGNKFKYDPDI
LDQKIIRASDEIIKDVKKDAWFLIQDQPDKKVDEQDDD


>TTHERM_00400821(coding)
ATGTCTGTACCTGTTTAGTATATTGCTGATTATTCTAACACCCCAGAAGCTAGGCTAAAG
AAAAATCATTAAAAATATTGCCTCTACTTAAAGCCTGCTGATAGGGATTATAGTAGTTCA
TTTGAAATTCAAGAAAATAGGGGATTCTTTCCTGAAACATTATACATTTTTGTAGAAGCA
TTTCATGAAAAGTATAAAGAAGTTTATGAATTTCTTATTAAAATAGCTGAGCCTGTAAAC
AAACCAAATTTCATCCATGTGTATAAAATAACTCTGTTTTCTATGTATACTGCAATGAGT
TTGAATTTAAATGCAGAAAAGATCATCGAAAGCTTGATGTAGTACTCTAAAAATGAGGTG
ATTCCTAAAAGTTTTATTGAATTTATAGAAAACAAAACTAAAAAAGCAGGGTCTGCTTAT
CTTTATATGATTAAAAAGAATTATTATCTCAAAATTCATTAAGAGTTTCTTGAAAAAATC
ATCCGTATTGATGAGGAACCTTATAAAAGTATAATAGAAATGGAATAAAATCCTCCTTAG
TAATTGCTTTAAACTTAAGAGGAGTCAAGAGTTTGGAATTTCAAATTCTACAGAATCAAA
TAAAAACACAATTTGTTCCAAATCACTGAGAAAATTATAAAAGAAGGAATTTCATTAATT
AACGAATATCATGATGATAAAGAAAGTCAAAATGATCTAAGTAGTAATGTCTAAATACCA
TATAAAAAGTTAGATATTGAGCTTAGGTAAATCACTCAGCCAAGAATATACCAACAAAAA
GCACTTAAAAATATATTCGTTTGTGAAAAACCTAGAAGTGCTACTATTGTTCTTCCATGC
GGCGCTGGAAAGACATTGTTGGGCATCATAGTAACCGAAAAAATAAAGGGAAATACTATT
GTTATATGCGATATAGATACAGCTACTAAACAATGGAAGAATGAATTTATAAGATGGACA
ACAGTTAAACCAGATAGAATTAAAATTTATACTGGTAAAACTAAGAATTTGCAAGAAAAG
CAAACGAAACCTTTTATACTGATTACTACATTTAAGCAACTCTCTAGTATTATCAAATCA
AATAAACTTCAAAAAGAAAAGAGATAAGATATGGATACGTCATCCAAATATGAAACCAAA
ATGGATCATTACATTTAAGAAGAAATGGAATGGGATTTGTGCATAGCTGATGAAACCCAA
TACTCAGCTGCTTCTACATATAAAAAAATATTCGAGGAATTCAATTTTAAATTGAAGATA
GGATTAACTGCAACTCCATACAGAGAAGATAATAAAATAGATGATCTTTTCCACGTTATT
GGTCCTAAACTTTATGAAGCGAATATATCAGAGCTAATTTAGGACAGCTATTTAGCTAAG
CCATATTGCGTTGTATTTCGTTGTAAAATGCATGAATGTTGCGAAGATTTTATGAAAGAC
AGAAAATTTAAAAATAAGCCTTCTTTGTAGTCTGGAAATCCAGAAAAATTTAAACTTTTG
TATTACTTAATTAAGTTCCACGAATCAAGAAAAGATAAGATTTTAGTCTTTTGTGATTAG
ATTCCTGTACTCAAATACTACTCTTAAAAAATGGGATATCCTGCAATATATGGTGAGGTA
GGATTGCTAGAAAAGCTAGTTTGGTTGGATTTATTTAGAAAGGGAGAAATTAATACATTA
TTTTTGAGTCGTGTTGGTGATACCGCACTTGATCTACCTATTGCAAATGTGTGTATTTAA
ATAGGATTTTAATTTGGTTCAAGAAGATAAGAAGTTTAAAGACTTGGAAGAATTATGAGA
AGAAAAGAAGGACAAAAAGGAGAATATAATGCTTTCTTTTATACTATTGTCTCTAAAAAT
ACAGAGTAGGCTTAGTTCTATTACAGAAGATAAAAATCTTTAATGGATCTAGGTATTAAT
TTTGAAGTAATAGATATAGATGAACAGAATGGTAATAAATTTAAATATGACCCAGATATC
CTAGATTAAAAAATTATAAGAGCTAGTGATGAAATAATAAAAGATGTAAAAAAAGATGCT
TGGTTTCTTATTTAAGATTAGCCTGATAAAAAAGTAGATGAATAAGATGATGATTGA


>TTHERM_00400821(gene)
ATGTCTGTACCTGTTTAGTATATTGCTGATTATTCTAACACCCCAGAAGCTAGGCTAAAG
AAAAATCATTAAAAATATTGCCTCTACTTAAAGCCTGCTGATAGGGATTATAGTAGTTCA
TTTGAAATTCAAGAAAATAGGGGATTCTTTCCTGAAACATTATACATTTTTGTAGAAGCA
TTTCATGAAAAGTATAAAGAAGTTTATGAATTTCTTATTAAAATAGCTGAGCCTGTAAAC
AAACCAAATTTCATCCATGTGTATAAAATAACTCTGTTTTCTATGTATACTGCAATGAGT
TTGAATTTAAATGCAGAAAAGATCATCGAAAGCTTGATGTAGTACTCTAAAAATGAGGTG
ATTCCTAAAAGTTTTATTGAATTTATAGAAAACAAAACTAAAAAAGCAGGGTCTGCTTAT
CTTTATATGATTAAAAAGAATTATTATCTCAAAATTCATTAAGAGTTTCTTGAAAAAATC
ATCCGTATTGATGTAAGCAATTTAATTCCATCTTGTTTTTATTTCCATTACTGATTCTAA
TCCAAATTATTAATTAATTATTGTAAAAATAGGAGGAACCTTATAAAAGTATAATAGAAA
TGGAATAAAATCCTCCTTAGTAATTGCTTTAAACTTAAGAGGAGTCAAGAGTTTGGAATT
TCAAATTCTACAGAATCAAATAAAAACACAATTTGTTCCAAATCACTGAGAAAATTATAA
AAGAAGGAATTTCATTAATTAACGAATATCATGATGATAAAGAAAGTCAAAATGATCTAA
GTAGTAATGTCTAAATACCATATAAAAAGTTAGATATTGAGCTTAGGTAAATCACTCAGC
CAAGAATATACCAACAAAAAGCACTTAAAAATATATTCGTTTGTGAAAAACCTAGAAGTG
CTACTATTGTTCTTCCATGCGGTAATTAAATAATCACTCTATCTATTACTTTTATTTTTC
CATTAAAATATAAGCGTCTAATTACTATTAAAAATAATTGGTTTTTAGACACTTTTAAAA
AATAAAATTGTTTTTTTAATATTAAATTATTCTAATTTTAACAGGCGCTGGAAAGACATT
GTTGGGCATCATAGTAACCGAAAAAATAAAGGGAAATACTATTGTTATATGCGATATAGA
TACAGCTACTAAACAATGGAAGAATGAATTTATAAGATGGACAACAGTTAAACCAGATAG
AATTAAAATTTATACTGGTAAAACTAAGAATTTGCAAGAAAAGCAAACGAAACCTTTTAT
ACTGATTACTACATTTAAGCAACTCTCTAGTATTATCAAATCAAATAAACTTCAAAAAGA
AAAGAGATAAGATATGGATACGTCATCCAAATATGAAACCAAAATGGATCATTACATTTA
AGAAGAAATGGTAATTAATTTATTCACAAAAGTGGTTTCAATTATTTAAACTTGATTGAT
TTAATTTAATAGGAATGGGATTTGTGCATAGCTGATGAAACCCAATACTCAGCTGCTTCT
ACATATAAAAAAATATTCGAGGAATTCAATTTTAAATTGAAGATAGGATTAACTGCAACT
CCATACAGAGAAGATAATAAAATAGATGATCTTTTCCACGTTATTGGTCCTAAACTTTAT
GAAGCGAATATATCAGAGCTAATTTAGGACAGCTATTTAGCTAAGCCATATTGCGTTGTA
TTTCGTTGTAAAATGCATGAATGTTGCGAAGTAAACTTAATTTAAAAAAAAAAACATTTA
TTACTCATCAATTTTTATTATTAAAAAATTATAAAATTATAATCAAATTCTATTTTCACT
AATAAAAAAAAACTAATTACTTAACATTTATTTATTATATTACAATAGGATTTTATGAAA
GACAGAAAATTTAAAAATAAGCCTTCTTTGTAGTCTGGAAATCCAGAAAAATTTAAACTT
TTGTATTACTTAATTAAGTTCCACGAATCAAGAAAAGATAAGATTTTAGTCTTTTGTGAT
TAGATTCCTGTACTCAAATACTACTCTTAAAAAATGGGATATCCTGCAATATATGGTGAG
GTAGGATTGCTAGAAAAGCTAGTTTGGTTGGATTTATTTAGAAAGGGAGAAATTAATACA
TTATTTTTGAGTCGTGTTGGTGATACCGCACTTGATCTACCTATTGCAAATGTGTGTATT
TAAATAGGATTTTAATTTGGTTCAAGAAGATAAGAAGTTTAAAGACTTGGAAGAATTATG
AGAAGAAAAGAAGGACAAAAAGGAGAATATAATGCTTTCTTTTATACTATTGTCTCTAAA
AATACAGAGTAGGCTTAGTTCTATTACAGAAGATAAAAATCTTTAATGGATCTAGGTATT
AATTTTGAAGTAATAGATATAGATGAACAGAATGGTAATAAATTTAAATATGACCCAGAT
ATCCTAGATTAAAAAATTATAAGAGCTAGTGATGAAATAATAAAAGATGTAAAAAAAGAT
GCTTGGTTTCTTATTTAAGATTAGCCTGATAAAAAAGTAGATGAATAAGATGATGATTGA