Identifiers and Description

Gene Model Identifier

TTHERM_00392850

Standard Name

None

Aliases

PreTt23513 | 42.m00247 | 3813.m01468

Description

ATP dependent DNA ligase domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11490.19.99709313703352e-262ATP dependent DNA ligase domai
n-containing protein (555 aa)
OxytrichaContig22262.0.g66.00290466224237e-91ATP dependent DNA ligase domai
n
DictyBaseDDB_G02744930.00010003404299093lig1 on chromosome: 2 position
4400712 to 4404415

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00392850(coding)
ATGATCAAAATTGATTTAACAAAACCTGTATTTCTTAATTTTAATCAATCAAAGTTTTGG
GAAATCAGCCTGCTTGATGGAAATAAATCTTAAATCAGATATGGAAAGTTGGTTTAAGGT
GAAGAGATTGAAGAGAAAACTTAAATTGTCCAAAAGTAGCACAAAGACACTGACTCTTGT
TTAGATTACATAATAAGAGTGATTGAAAACAAAAAATTGAAAGGATATAGCGGAGATATT
CCCATGAAAAAGAATGAGCCTTAAATCATCATTCCTGCAAATAACGCAAGTGGATTTTCA
ATTTAAATTTCAGCACCTAAATCTGTTGAAAATAATGCTAACGATGATAAAGATTCTAAA
GTTGATTCAAATACTCAAGCGTATTTATAGGAAAACAAAACTTGGTCATCATAATTTGTA
ATTTTAACTCTGTCTGGCAATGAAGTAGAAGAAATTATAGGCAAACTAGGAATAAAAAAG
ACATGGGAAAAAAGTTCTACAATATTAAGTGCAAACTAGTGTAAATTGTATTTCAAAAAT
TAAATTGAGGAATACGAAAGAAAGGGATATGTGAGAGATGATAGTCAATATAATTTTTAG
CTAAATGAAGTTAATAAACACTTTTCAGCATAAAATGGATCTAGTAATAATAATTAGCTT
GATCTCAACTAGAAAGGCAAAAAGAAAAATTTTAATAAAGATTCAGGGTTATACGACGAT
TCACATTCAAATATTTCAGGTATCTCAGATTAGTCAGATTTAACTGCTAGGTCTGGTGGC
TCTTAATTAGATTTATCATTCGACAAGGGTGATGATGATGATGGTAATAGCTCAGTTGTT
GTAACTGGAGAAATTAAAAAAGGTTCTTTAGGTGCTAACGGAAGTATGGATTCAGGTGTA
CTTTTAGCTTAAGCAATGCCAGATGAAATGGATCCAACTGGCTGGTATGCAAGTGAAAAA
ATGGATGGAGTCAGAGCTGTTTGGACTGGAAAGACATTTTATTCTAGGAATGGTAACGAA
TTCTACCCTCCTCCATTTTTCATTTAAAATTTCCCAAATTGCACTTTAGATGGGGAATTG
TTTACAAAAAGAGATGATTTCTAGCGTTGTGTGGGTATTGTTAAGACAAAAAATGGAAAT
GAAGAAAAAGATGAAAGGTGGAAAGATATTGTTTACTTAGTTTACGACTGTCCTAAATTA
TTAAAACCCTTTAAAGATAGAATAAAAGCTTTACAAGAATAAATTCCAAAACTTGGTAAC
AAGTACATTAAAGTTCTTCCACATAAGATAGTGGAGAGCAGAGAATAACTTGAATCAGAG
CTTGATAGAGTCTTAAAAAATAATGGCGAAGGTTTGATGTTAAGAGATCCTAATTCAATG
TATGAATGCAGAAGATCAAAAACCCTTCTTAAGGTAAAAACATTTACAGATGAAGAAGCT
ACAGTAATTGGGAGTGAAAGAGGTGAAGGAAGATGTGCAGATATGATGGGTGCTTTGGTA
TGCCGTATGAAAAATGGAAAAGAATTCAAAATAGGATCAGGATTCAATGATGACTAAAGA
AGAAGGCCACCTAAAAAAGGAAGTGTGATAACATTCAAATACCAAAATCTTACCAAAGAT
GGTAAACCAAGATTCCCTATTTTCTTGAGAATAAAAGAAGACGAATGA


>TTHERM_00392850(protein)
MIKIDLTKPVFLNFNQSKFWEISLLDGNKSQIRYGKLVQGEEIEEKTQIVQKQHKDTDSC
LDYIIRVIENKKLKGYSGDIPMKKNEPQIIIPANNASGFSIQISAPKSVENNANDDKDSK
VDSNTQAYLQENKTWSSQFVILTLSGNEVEEIIGKLGIKKTWEKSSTILSANQCKLYFKN
QIEEYERKGYVRDDSQYNFQLNEVNKHFSAQNGSSNNNQLDLNQKGKKKNFNKDSGLYDD
SHSNISGISDQSDLTARSGGSQLDLSFDKGDDDDGNSSVVVTGEIKKGSLGANGSMDSGV
LLAQAMPDEMDPTGWYASEKMDGVRAVWTGKTFYSRNGNEFYPPPFFIQNFPNCTLDGEL
FTKRDDFQRCVGIVKTKNGNEEKDERWKDIVYLVYDCPKLLKPFKDRIKALQEQIPKLGN
KYIKVLPHKIVESREQLESELDRVLKNNGEGLMLRDPNSMYECRRSKTLLKVKTFTDEEA
TVIGSERGEGRCADMMGALVCRMKNGKEFKIGSGFNDDQRRRPPKKGSVITFKYQNLTKD
GKPRFPIFLRIKEDE


>TTHERM_00392850(gene)
ATGATCAAAATTGATTTAACAAAACCTGTATTTCTTAATTTTAATCAATCAAAGTTTTGG
GAAATCAGCCTGCTTGATGGAAATAAATCTTAAATCAGATATGGAAAGTTGGTTTAAGGT
GAAGAGATTGAAGAGAAAACTTAAATTGTCCAAAAGTAGCACAAAGACACTGACTCTTGT
TTAGATTACATAATAAGAGTGATTGAAAACAAAAAATTGAAAGGATATAGCGGAGATATT
CCCATGAAAAAGAATGAGCCTTAAATCATCATTCCTGCAAATAACGCAAGTGGATTTTCA
ATTTAAATTTCAGCACCTAAATCTGTTGAAAATAATGCTAACGATGATAAAGATTCTAAA
GTTGATTCAAATACTCAAGCGTATTTATAGGAAAACAAAACTTGGTCATCATAATTTGTA
ATTTTAACTCTGTCTGGCAATGAAGTAGAAGAAATTATAGGCAAACTAGGAATAAAAAAG
ACATGGGAAAAAAGTTCTACAATATTAAGTGCAAACTAGTGTAAATTGTATTTCAAAAAT
TAAATTGAGGAATACGAAAGAAAGGGATATGTGAGAGATGATAGTCAATATAATTTTTAG
CTAAATGAAGTTAATAAACACTTTTCAGCATAAAATGGATCTAGTAATAATAATTAGCTT
GATCTCAACTAGAAAGGCAAAAAGAAAAATTTTAATAAAGATTCAGGGTTATACGACGAT
TCACATTCAAATATTTCAGGTATCTCAGATTAGTCAGATTTAACTGCTAGGTCTGGTGGC
TCTTAATTAGATTTATCATTCGACAAGGGTGATGATGATGATGGTAATAGCTCAGTTGTT
GTAACTGGAGAAATTAAAAAAGGTTCTTTAGGTGCTAACGGAAGTATGGATTCAGGTGTA
CTTTTAGCTTAAGCAATGCCAGATGAAATGGATCCAACTGGCTGGTATGCAAGTGAAAAA
ATGGATGGAGTCAGAGCTGTTTGGACTGGAAAGACATTTTATTCTAGGAATGGTAACGAA
TTCTACCCTCCTCCATTTTTCATTTAAAATTTCCCAAATTGCACTTTAGATGGGGAATTG
TTTACAAAAAGAGATGATTTCTAGCGTTGTGTGGGTATTGTTAAGACAAAAAATGGAAAT
GAAGAAAAAGATGAAAGGTGGAAAGATATTGTTTACTTAGTTTACGACTGTCCTAAATTA
TTAAAACCCTTTAAAGATAGAATAAAAGCTTTACAAGAATAAATTCCAAAACTTGGTAAC
AAGTACATTAAAGTTCTTCCACATAAGATAGTGGAGAGCAGAGAATAACTTGAATCAGAG
CTTGATAGAGTCTTAAAAAATAATGGCGAAGGTTTGATGTTAAGAGATCCTAATTCAATG
TATGAATGCAGAAGATCAAAAACCCTTCTTAAGGTAAAAACATTTACAGATGAAGAAGCT
ACAGTAATTGGGAGTGAAAGAGGTGAAGGAAGATGTGCAGATATGATGGGTGCTTTGGTA
TGCCGTATGAAAAATGGAAAAGAATTCAAAATAGGATCAGGATTCAATGATGACTAAAGA
AGAAGGCCACCTAAAAAAGGAAGTGTGATAACATTCAAATACCAAAATCTTACCAAAGAT
GGTAAACCAAGATTCCCTATTTTCTTGAGAATAAAAGAAGACGAATGA