Identifiers and Description

Gene Model Identifier

TTHERM_00390080

Standard Name

None

Aliases

PreTt24904 | 41.m00311

Description

folate/biopterin transporter; folate/biopterin transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03092 ) BT1 family
  • ( PF03209 ) PUCC protein
  • ( PF03253 ) urea transporter
  • ( PF01461 ) 7TM chemoreceptor
  • ( TIGR00900 ) H+ Antiporter protein
  • ( TIGR00901 ) AmpG-related permease
  • ( PF01252 ) signal peptidase (SPase) II
  • ( TIGR00788 ) folate/biopterin transporter
  • ( TIGR00880 ) Multidrug resistance protein
  • ( PF07690 ) transporter, major facilitator family
  • ( TIGR02718 ) siderophore transporter, RhtX/FptX family
  • ( TIGR00055 ) di-trans,poly-cis-decaprenylcistransferase
  • ( TIGR00792 ) sugar (Glycoside-Pentoside-Hexuronide) transporter
  • ( TIGR00895 ) MFS transporter, aromatic acid:H+ symporter

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 23.3%

TetraMine Data

TTHERM_00390080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04543.19.997093137033517e-262folate/biopterin transporter (
526 aa)
OxytrichaContig261.1.g301.9994274381022833e-63BT1 family
Stentor CoeruleusSteCoe_201386.991989996645917e-56

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00390080(coding)
ATGCTAGGACCCTCTGTAACAAAATGGTTTATTGATAATGATGAGTTTGTTGGTAAATAT
CTCGTCGTATGTCTAGTCGCTTTAGCCTAAGGTGTTTTAGCTCTCTCAGAAGTTCCTATT
AACTTCTTATATAAAGATAATTATAATATGTCACCTGCAGAGGTCTCTTTTGTAGTAGGA
ATAATTGCTCTTCCATGGGTTTTCAAACCTATTTATGGAATTATGAGTGATTCAATTCCA
ATATGCGGTGAAAGAAGAAAGAGCTATATCATGATATTTTCTTTTTTAGCTTTTGTGAAT
TGGATGCTTCTAGCCTTTTATGTTCGTGAAAAAGCAGTTGGTCTAGTCATTTTGTTTAAT
ATTTAATTCTGCACAGCTTTTTGCAATGTTGTTGGTGAAGCTATGTTAGTTGAAATTTCT
CAACTCAAAAGTAAAAAATTTAACATGAATGATCAAGAGCAATAGGCTGAAGCTTCTTAA
AATGTTTCACTGTTTTTTGGTGTGAAAAGCTTTGGTACTCTTGCAACTGCTTATTTAGGA
GGCTTTCTATTAGAGGTTATGGATAAGTATTACATATTTGCAATTACTGGTATTTTTCCC
TTTTTACTATTTGTCAGTACTTTTTATATGGTTGATCAATAGAGTACTGAAGACCTAACG
GAGAGCTAACAGAATCGTAATCTTAGTCAAATATAGCTATTTTTTAGATTCCTTAAAAAA
CCCTAAATCTACTAACCTTTAATTTTTATTTTCCTCTTCGCTGCTACTCCAACTAGCTCA
AGCAGTATGTTCTTTTTCTATACTAACTAACTTGGATTTGAACCTTAGTTTATGGGTTCT
TTGAAATTTATCCATGCTGCAGGCACTCTTTTAGCAATATTTATATATAACAAATATCTT
AAAACTGTAGAATTCTCGCTTTAGTTTATTGTTTCTACTTTATTTTGTGTTGTACTAGGA
CTCTCATAAATATTATTAGTAACTCGCTTAAATGTTCAGATGGGAATACCTGATAAATTA
TTTTGTTTAGGAGACTCTATCATCATATAAATTGTTGGAGAACTCAATATATTACCTTTA
TTGGTTTTAGCTTGCAGATTATGTCCTCGTACCATAGAAGCAACTATGTATGCGATGATT
ATGAGCACTCTAAATCTTGGAAGTCTTGTTTCTTCATAATTAGGAGGAGTTTTAATTTAT
CTTTTAGGTATAACTGAAGATAATTTTGATAATTTGTGGATACTTATTTTAATTGCTAAC
TTAACAAGTGCAGTTCCTCTTGTAGGTATAAGCTTGATAGATTAAAAAGGTAAAAAGTTA
AGTGACAGCGATTTATCAAGCAAATCTAATTCTGAAATTCCTGATAATATCTCTCTTCCA
GACAAAGAAGAAGTAAAAAGTGAGAGGTCTTCTCTTGTTGATCATGATTCAAACACTTCT
ACAGACTATAAAAATTATGGAGCTTTAGAATAGAACGAACCACTTTAGCATTAAGAAATG
CTCCATATTTAAGAATAATAAAAGAAAATCGATGCCACAGGTATTTGA


>TTHERM_00390080(protein)
MLGPSVTKWFIDNDEFVGKYLVVCLVALAQGVLALSEVPINFLYKDNYNMSPAEVSFVVG
IIALPWVFKPIYGIMSDSIPICGERRKSYIMIFSFLAFVNWMLLAFYVREKAVGLVILFN
IQFCTAFCNVVGEAMLVEISQLKSKKFNMNDQEQQAEASQNVSLFFGVKSFGTLATAYLG
GFLLEVMDKYYIFAITGIFPFLLFVSTFYMVDQQSTEDLTESQQNRNLSQIQLFFRFLKK
PQIYQPLIFIFLFAATPTSSSSMFFFYTNQLGFEPQFMGSLKFIHAAGTLLAIFIYNKYL
KTVEFSLQFIVSTLFCVVLGLSQILLVTRLNVQMGIPDKLFCLGDSIIIQIVGELNILPL
LVLACRLCPRTIEATMYAMIMSTLNLGSLVSSQLGGVLIYLLGITEDNFDNLWILILIAN
LTSAVPLVGISLIDQKGKKLSDSDLSSKSNSEIPDNISLPDKEEVKSERSSLVDHDSNTS
TDYKNYGALEQNEPLQHQEMLHIQEQQKKIDATGI


>TTHERM_00390080(gene)
ATGCTAGGACCCTCTGTAACAAAATGGTTTATTGATAATGATGAGTTTGTTGGTAAATAT
CTCGTCGTATGTCTAGTCGCTTTAGCCTAAGGTGTTTTAGCTCTCTCAGAAGTTCCTATT
AACTTCTTATATAAAGATAATTATAATATGTCACCTGCAGAGGTCTCTTTTGTAGTAGGA
ATAATTGCTCTTCCATGGGTTTTCAAACCTATTTATGGAATTATGAGTGATTCAATTCCA
ATATGCGGTGAAAGAAGAAAGAGCTATATCATGATATTTTCTTTTTTAGCTTTTGTGAAT
TGGATGCTTCTAGCCTTTTATGTTCGTGAAAAAGCAGTTGGTCTAGTCATTTTGTTTAAT
ATTTAATTCTGCACAGCTTTTTGCAATGTTGTTGGTGAAGCTATGTTAGTTGAAATTTCT
CAACTCAAAAGTAAAAAATTTAACATGAATGATCAAGAGCAATAGGCTGAAGCTTCTTAA
AATGTTTCACTGTTTTTTGGTGTGAAAAGCTTTGGTGTAAGCTATTTAAAATTTCAATAA
ATTATTTTTTAAAACTTTTGTATGAAATTATTTTAAATTCAATCAATCAATCAAGCCACT
CATTTATTTATTCATTCATTCACTCTAGTTACTATTTTACTTATAATTAAAAGATATTTA
TATGTTTCTTTTCTATTAAACTTAAAGCTCCTTTTTAATTTTAAAATATTTTTTTATCTA
TTTAAGTTAATCTTTTTCAAAAATTTATAATATCTTAAACTTAAAATAGACTCTTGCAAC
TGCTTATTTAGGAGGCTTTCTATTAGAGGTTATGGATAAGTATTACATATTTGCAATTAC
TGGTATTTTTCCCTTTTTACTATTTGTCAGTACTTTTTATATGGTTGATCAATAGAGTAC
TGAAGACCTAACGGAGAGCTAACAGAATCGTAATCTTAGTCAAATATAGCTATTTTTTAG
ATTCCTTAAAAAACCCTAAATCTACTAACCTTTAATTTTTATTTTCCTCTTCGCTGCTAC
TCCAACTAGCTCAAGCAGTATGTTCTTTTTCTATACTAACTAACTTGGATTTGAACCTTA
GTTTATGGGTTCTTTGAAATTTATCCATGCTGCAGGCACTCTTTTAGCAATATTTATATA
TAACAAATATCTTAAAACTGTAGAATTCTCGCTTTAGTTTATTGTTTCTACTTTATTTTG
TGTTGTACTAGGACTCTCATAAATATTATTAGTAACTCGCTTAAATGTTCAGATGGGAAT
ACCTGATAAATTATTTTGTTTAGGAGACTCTATCATCATATAAATTGTTGGAGAACTCAA
TATATTACCTTTATTGGTTTTAGCTTGCAGATTATGTCCTCGTACCATAGAAGCAACTAT
GTATGCGATGATTATGAGCACTCTAAATCTTGGAAGTCTTGTTTCTTCATAATTAGGAGG
AGTTTTAATTTATCTTTTAGGTATAACTGAAGATAATTTTGATAATTTGTGGATACTTAT
TTTAATTGCTAACTTAACAAGTGCAGTTCCTCTTGTAGGTATAAGCTTGATAGATTAAAA
AGGTAAAAAGTTAAGTGACAGCGATTTATCAAGCAAATCTAATTCTGAAATTCCTGATAA
TATCTCTCTTCCAGACAAAGAAGAAGTAAAAAGTGAGAGGTCTTCTCTTGTTGATCATGA
TTCAAACACTTCTACAGACTATAAAAATTATGGAGCTTTAGAATAGAACGAACCACTTTA
GCATTAAGAAATGCTCCATATTTAAGAATAATAAAAGAAAATCGATGCCACAGGTATTTG
A