Identifiers and Description

Gene Model Identifier

TTHERM_00390000

Standard Name

None

Aliases

PreTt24896 | 41.m00303

Description

Serine/Threonine kinase domain protein; Protein kinase domain containing protein. Sequence similarity to the ULK protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01163 ) RIO1 family
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF00533 ) BRCA1 C Terminus (BRCT) domain
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR01442 ) small, acid-soluble spore protein, gamma-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00390000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04533.19.997093137033517e-262protein kinase domain-containi
ng protein (1755 aa)
OxytrichaContig1082.1.g623.001416859614811e-48Protein kinase domain
DictyBaseDDB_G02923904.000139296874041e-45atg1 on chromosome: 6 position
1694801 to 1697129
SGDYGL180W4.9986056260133516e-43ATG1 Protein ser/thr kinase re
quired for vesicle formation i
n autophagy and the cytoplasm-
to-vacuole targeting (Cvt) pat
hway; structurally required fo
r phagophore assembly site for
mation; during autophagy forms
a complex with Atg13p and Atg
17p
WormBaseWBGene000067861.0002335610448659e-38locus:unc-51 Serine/threonin
e-protein kinase unc-51 stat
us:Confirmed UniProt:Q23023
protein_id:CAB60406.1
Stentor CoeruleusSteCoe_338641.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00390000(coding)
ATGGATTTACTTCTTAAATACTCTCCTGATAAACAAATTGAAAATTATGCATTTTCATTA
AGTGCATGTATCGGTAAAGGATCTTCTGGTACCGTTTATGTTGGGAGACATTAGTAAACT
TAGCAAGTAGTAGCAATTAAAGCAGTTGATATGCGCTCTTTGAAAACCGAGTACGCTTGG
AAAATGCTTTGTTCTGAAGTCAAGATTATGAAGAAGCTAAAGCATCCACATGTCGTGCGT
CTTCTGGATGTCTTTTAAACAAAAAATAATACATATATCATTACAGAATTTTGTAATTAA
GGAGATTTGCGTACTTACTTAAAGAAGAAAAAATCTTTAACTGAGAGAGAAGCGATCACT
GTAATTTCATAGATAATGAGCGGTTTGTAGGAGCTTGCAAACAATGGAATAATTCACCGT
GATTTAAAGCCTGCAAATATTTTGATTCACGATGACGTATTTAAAATTACAGATTTCGGA
TTTGCTAAAAAATTAGATAGCATGGAAGATCAGCTTATGGATTCTTTAGTAGGAACTCCA
CTTTATATGGCACCTTAGATTTTAAATAAATAGTAATACACTTCAAAATGCGATGTTTGG
AGTATTGGTCTTATTTTATATGAATTATTATTTGGTCGCACACCTTGGCCAGCAGTAAAT
GTTGTTGATCTAGTCTAAAAAATGTGCACGGTTCCTCTCTAATTCCCCAAAGACCAATCA
ATTTCTTAAGCTTTAGTCAATTTTATTAGCAAGTGTTTGCAATTCCCTGAATCAGATAGA
ATAAGTATTCAGGAAATGTGTGCAAATTCCTTATTCGAAGATTACGTATAGCAAATTAAT
AGATTATTGAGTTAGCAAAAACTATAAAATCATCCATCAGGAAGTTCAACTAATACCAAT
TCATAAAATAACTTATCTGATTTTTCAAGTGTGGCCACATAAGCATAAAAAAATGTATAA
AATAATAGCAGCGCAAATGATACTTAAACACCTGGAGCAGCTTATAATCGCAATTAAAAG
TAACCACAAATAGGATATTAGTAGGGATAGACTAATTAAATAAATGTTCAATAAGAAAAA
GTAAATTAATATTAAAATTAACCAAGCGCAACAAATTTAGGTGTCACCCCAAGCTCAGGT
ATGAATATGCAAATAAATTTGAACACTTAACCTTAGTCATCTTAATAGAGCAGTTCGATG
TCTCCAGTGAGAGCTCCAGCATTGTAATAACAGTCAGGATCAGGCAGAACCACAGAAAGG
AATGTTTAGATTCAAGAATAAAATGGTGGATGTTCCCCCTTAAAGCAGCTTAGCAATTAA
AACGAACCTTATTCTCCTATATCTCCTATTCGCACAAATTACTAAAAGTAGCAAAGTGCA
TCTTCTTACAACTCCTAAATAAAGAGCATGAATTCGATTTAGGATTAACTTGCTTAGGCT
AATGGTATTAATTCTTCATAAAAAAACATGTCTACAAGTAAGCAAAATATTTAACAATAT
CCAAATCAACCTAAAAACTATCCTAGCTCTTTCCATAACTTGAACGCCTTTCCACAATAA
GAAAAAAATATTCAATCTTCTGAAGGAAACGAAAATCAAAATGTAAAGTAACCTGCATTG
GTAAATAACTTTGTTAAATAATCAAAAGATTAATCCCCTACAAAAACTGGATTATATAAT
GATAATAACTTCTATTAAGTATTAAATAACGTTTCTAATTACGACAAAGGTTTAGTTGTT
GAATAGCAGTAGTAACAAAATCAGCTTAAATCATTTAACGATGAGTAGAAAAACTAACCT
TTTGGATACTCTTCAAACCAGTAAAAATAAAACTTTTAAGGACTCCCACCTCAAAGTTAA
GCTTCCTAGAATAGTTAATTCGGAGTACAAAGATAATACACAAATGAAACAGCAAGTAGC
CCTTAGTCTTCCTCTCCCACTATCGTTTAATTATAATCAGCATATTCTCAGTAAGGTTAA
AATATTCCAGCCTTGCAAATTTAATAGAAACCAGAGCTTAAAGCAGAAGTTATGTTTAAT
AATATAAATAATGGCTAAGTATCGCCTTACAGATAGCAAGATGGTGCTGACAGAAAATTT
TAAGAACGAGGATTATTTTTACAGTAGGTGTAAGATTAATCTCCTGTTGCAACTAACCTT
AATATTGAAAGTAAAAATAGTGGACTGTACTTATAGTAGCAGGTATCACAGCCTTATCAA
AATAACACTAGTATTAGTAATAAGTAATAGGATAATTAAGGAGTTAACTTAGATTCAATG
AATACAAACACATATAATAATTAAGGGAAGTTTGATGAATCACGCTTTAACTAAGTGTAG
CTTAAATAGTACTCTCTTTCTCATTAATATTCACTCAGCAGGTAAAACCAACCAGATTAA
AATAATTAAGCAGCAACTCCTAATAGAAACATATCTCCTTAGAGTAAAAACTAAAGTGTA
TACACAAGCGAAAAGAATTCAAGTAGTGAATAAAGTCCTACCTCTTCTGTAAATCAATAA
GCTGGGTAATACATTCTCTAACAGCCTTAAACTTAATTTGTATAAAACCGCTATTCTCAA
AATAATAATTCAAATTCAGCAAGTGGGTATTCCACAGTGATAAAAAGCGGAGACAATTCT
TCTAACCAAGATCAAGTAAATAGCAGATAAAATAGTCCATCGAACTATAATCCATCTAAT
AATTATTAACAGCAATAATAATAGTAAAATGTTTCTTTACAAAATCAATAAATTTAACAA
CTGCAAGCAAATTAATAACAAATTTAAAAGCAAAGAAGTGGTGGAGATTCTCCAGATATT
CGTTATAAAGCCTACTCATTTACCGCTTCTAATGGATTGATAATGAATAAGAGTGGAGGT
CTCAATAACACAAATATATCCACAAGATCTATCACAGCTACAAATAATTCGAATTCTTCA
CCTAAAAATAATGATTCAGAAGGTAAAATTTCATACAACTCTAACGGCTACCATTCTCAA
TAGTAACAATAGTAGTAGTAATAACAAATAAATAACTCCAAAAACACATCAAGCAATCAT
GTAATTTTTGGAAATCTCGATTAATAAGAGATTGGAGACTATAAAAACTAGAGACAAGCT
CAGTAAAATAGCGGCTAAAAAAAGGACTATGAGTCTGTAATCTAAATTCCATATGAATCT
AATGGGAATAATCTAAATCACTAAAATATTCCATTTAACTACAAGAGGTCAATGACTCAA
AACAATGAACATTAAGATTATGAATTAGACAATTACAAAAACACATATACCCCTAAAAAC
AACAGTGGTGCACATTCCTACGCCAACTTATAAAAGATGTAAGGCATATCTTAGAATGAA
TTCAGAAACAGCAGTCCCAATTCAGTAGCACAGTTAATTGCTAAGAAAAATAGTGAATAA
AATTAACTGCCTAGATCCCCTCTAGAGAGAAGAAGAAAAAGTGAATTTGGAATTGGGTTA
TCAAATAAAAATTAAATTTATCAGAAGGAAATAAAGAATACTCCTTTCTAATAGTTTTCT
TAAGCTTAATTACCAAACAACTCTCGCAATCAAATAACATTTTACACATCAAATACACAA
CAAGTTAAAAACCAATTTTTACAAAGTGAAGAAAACTATGGAAAAAATAATATCTTGAAT
TAAGCAGGCAATGTCTAAAACCCAGCAATCGTTTAGAATTAGTACAGCAGAAGCAGAAGC
TTACACAATAATGCTGCAAGTAAATATAGTAACACTCACAATATTTCTCCAGCTAACACA
GGAATTAGTCCTAAAAATTCAAATAATTCATTATCTGATATCAAAAAAAAGCAGATCAAT
ACTCAAGATTATTCCAAAATTCCCTCATAATTTTTCGGAAATAGTACTTCCCCAAAAGCT
CAAACAAAGTATTAAGCATATCTGCAAAATACCTTGTAAGTTAAGAATTAATAATAAGGT
GTTAATTAGCCTACTAATTTAATAGTCTAAAAACATATATAACAATCAGGGAATGAACCT
CAGTAAATGAATGAGATTTAAGGCAATTAGCAATTTAAGGAAATACAAAGAGAACCATCA
TAGTAGCTTACTGCTGATAACTCACCAAACAAGTATGCAAAATATGCTTTGAAAAATTAT
TTATTGTCTTAAAATAACCAAGGTTCTAGTGCTGTAAATTATAACAACTCCAATATTTAA
AATTAAAATAATACTTCTTCTTAAATGAACAGTAGTGGAAATAAGAATACTTAAAATTTA
AATATTAATAGCAAGACTTAAAATAGTCTAGATAATTTAGGATCTAATTAACCACAACAA
CAATAGTAAATATTGAGAAATCAAAATTAGTATAGTTAAATAAATCCTCACCATCATGGA
CACAGTAAATCGTTTTCAAATAACTTTAATTAACCAATAGTGTCTCTTAATTCTTAGTAA
GAAATCACATAAATTGAAAATACAAGCAATAATAACATGAATAGTAATAGTACTTAAAAT
GAGTTCTATGCTTAGGACAATATGATAGAAAGTATACTTTGTATATGTAAGAGCGTTAGA
TTCTTGAAAAATTAAATAGATTACAACATCAAGAGCATTCTTAAGCTAGATGAACCATTT
TTATATGAAAAGTTAATATTCTTGTTGAATAAGCATCTTGTAATTCAGATTTCTATGCTT
AAAATCACTTAAATGGATAAAGGAATTAATGTAATTAACTTAGATAGATGGACTGAATAC
AGGGCAAGCCAAAATTTTAATGAAGTTTATAAAAAAATTGCTTAAAACTACTACGATATA
ATTAGTACTCACTAGAATAATTGGAATCGTGCTCATGAAAATCAAAGATTTTATGATGAA
TCAAAAAAAGATTACTATTTTAGTAAAATATTTAACCAGTAATTAACACAGTATAATAGT
CACACAAATAGTGGGTAAAATTCTTCTAATAGCAATCCTCAAAATAATGAAGAAGATAAC
ACTAATTTTTACTTTTACATTTACTAATTACTGAAGGAAATAATAAAAGAGGTGTTTAAT
AAATTGCAAAACAATCTATCAAAATATTTAGATTTAGACAATTCAAAGATTACTCGCGAA
GACAGCCTTGTTATAAACTGTTTAAGCAGACTTGTTGATTACCATCAATTGTTAAAATTA
ATTATATCATAAAAAGAAGACTTCTCATTGATACTCAAGTCAATAAATATAACTGAATTT
TTAAAAGAAAAGATTATAACAATTGAGTTCTATGAAGCCCTCAAATAAAAAATGTATATA
TATGATTTAATAACAAAATGA


>TTHERM_00390000(protein)
MDLLLKYSPDKQIENYAFSLSACIGKGSSGTVYVGRHQQTQQVVAIKAVDMRSLKTEYAW
KMLCSEVKIMKKLKHPHVVRLLDVFQTKNNTYIITEFCNQGDLRTYLKKKKSLTEREAIT
VISQIMSGLQELANNGIIHRDLKPANILIHDDVFKITDFGFAKKLDSMEDQLMDSLVGTP
LYMAPQILNKQQYTSKCDVWSIGLILYELLFGRTPWPAVNVVDLVQKMCTVPLQFPKDQS
ISQALVNFISKCLQFPESDRISIQEMCANSLFEDYVQQINRLLSQQKLQNHPSGSSTNTN
SQNNLSDFSSVATQAQKNVQNNSSANDTQTPGAAYNRNQKQPQIGYQQGQTNQINVQQEK
VNQYQNQPSATNLGVTPSSGMNMQINLNTQPQSSQQSSSMSPVRAPALQQQSGSGRTTER
NVQIQEQNGGCSPLKQLSNQNEPYSPISPIRTNYQKQQSASSYNSQIKSMNSIQDQLAQA
NGINSSQKNMSTSKQNIQQYPNQPKNYPSSFHNLNAFPQQEKNIQSSEGNENQNVKQPAL
VNNFVKQSKDQSPTKTGLYNDNNFYQVLNNVSNYDKGLVVEQQQQQNQLKSFNDEQKNQP
FGYSSNQQKQNFQGLPPQSQASQNSQFGVQRQYTNETASSPQSSSPTIVQLQSAYSQQGQ
NIPALQIQQKPELKAEVMFNNINNGQVSPYRQQDGADRKFQERGLFLQQVQDQSPVATNL
NIESKNSGLYLQQQVSQPYQNNTSISNKQQDNQGVNLDSMNTNTYNNQGKFDESRFNQVQ
LKQYSLSHQYSLSRQNQPDQNNQAATPNRNISPQSKNQSVYTSEKNSSSEQSPTSSVNQQ
AGQYILQQPQTQFVQNRYSQNNNSNSASGYSTVIKSGDNSSNQDQVNSRQNSPSNYNPSN
NYQQQQQQQNVSLQNQQIQQLQANQQQIQKQRSGGDSPDIRYKAYSFTASNGLIMNKSGG
LNNTNISTRSITATNNSNSSPKNNDSEGKISYNSNGYHSQQQQQQQQQQINNSKNTSSNH
VIFGNLDQQEIGDYKNQRQAQQNSGQKKDYESVIQIPYESNGNNLNHQNIPFNYKRSMTQ
NNEHQDYELDNYKNTYTPKNNSGAHSYANLQKMQGISQNEFRNSSPNSVAQLIAKKNSEQ
NQLPRSPLERRRKSEFGIGLSNKNQIYQKEIKNTPFQQFSQAQLPNNSRNQITFYTSNTQ
QVKNQFLQSEENYGKNNILNQAGNVQNPAIVQNQYSRSRSLHNNAASKYSNTHNISPANT
GISPKNSNNSLSDIKKKQINTQDYSKIPSQFFGNSTSPKAQTKYQAYLQNTLQVKNQQQG
VNQPTNLIVQKHIQQSGNEPQQMNEIQGNQQFKEIQREPSQQLTADNSPNKYAKYALKNY
LLSQNNQGSSAVNYNNSNIQNQNNTSSQMNSSGNKNTQNLNINSKTQNSLDNLGSNQPQQ
QQQILRNQNQYSQINPHHHGHSKSFSNNFNQPIVSLNSQQEITQIENTSNNNMNSNSTQN
EFYAQDNMIESILCICKSVRFLKNQIDYNIKSILKLDEPFLYEKLIFLLNKHLVIQISML
KITQMDKGINVINLDRWTEYRASQNFNEVYKKIAQNYYDIISTHQNNWNRAHENQRFYDE
SKKDYYFSKIFNQQLTQYNSHTNSGQNSSNSNPQNNEEDNTNFYFYIYQLLKEIIKEVFN
KLQNNLSKYLDLDNSKITREDSLVINCLSRLVDYHQLLKLIISQKEDFSLILKSINITEF
LKEKIITIEFYEALKQKMYIYDLITK


>TTHERM_00390000(gene)
ATGGATTTACTTCTTAAATACTCTCCTGATAAACAAATTGAAAATTATGCATTTTCATTA
AGTGCATGTATCGGTAAAGGATCTTCTGGTACCGTTTATGTTGGGAGACATTAGTAAACT
TAGCAAGTAGTAGCAATTAAAGCAGTTGATATGCGCTCTTTGAAAACCGAGTACGCTTGG
AAAATGCTTTGTTCTGAAGTCAAGATTATGAAGAAGCTAAAGCATCCACATGTCGTGCGT
CTTCTGGATGTCTTTTAAACAAAAAATAATACATATATCATTACAGAATTTTGTAATTAA
GGAGATTTGCGTACTTACTTAAAGAAGAAAAAATCTTTAACTGAGAGAGAAGCGATCACT
GTAATTTCATAGATAATGAGCGGTTTGTAGGAGCTTGCAAACAATGGAATAATTCACCGT
GATTTAAAGCCTGCAAATATTTTGATTCACGATGACGTATTTAAAATTACAGATTTCGGA
TTTGCTAAAAAATTAGATAGCATGGAAGATCAGCTTATGGATTCTTTAGTAGGAACTCCA
CTTTATATGGCACCTTAGATTTTAAATAAATAGTAATACACTTCAAAATGCGATGTTTGG
AGTATTGGTCTTATTTTATATGAATTATTATTTGGTCGCACACCTTGGCCAGCAGTAAAT
GTTGTTGATCTAGTCTAAAAAATGTGCACGGTTCCTCTCTAATTCCCCAAAGACCAATCA
ATTTCTTAAGCTTTAGTCAATTTTATTAGCAAGTGTTTGCAATTCCCTGAATCAGATAGA
ATAAGTATTCAGGAAATGTGTGCAAATTCCTTATTCGAAGATTACGTATAGCAAATTAAT
AGATTATTGAGTTAGCAAAAACTATAAAATCATCCATCAGGAAGTTCAACTAATACCAAT
TCATAAAATAACTTATCTGATTTTTCAAGTGTGGCCACATAAGCATAAAAAAATGTATAA
AATAATAGCAGCGCAAATGATACTTAAACACCTGGAGCAGCTTATAATCGCAATTAAAAG
TAACCACAAATAGGATATTAGTAGGGATAGACTAATTAAATAAATGTTCAATAAGAAAAA
GTAAATTAATATTAAAATTAACCAAGCGCAACAAATTTAGGTGTCACCCCAAGCTCAGGT
ATGAATATGCAAATAAATTTGAACACTTAACCTTAGTCATCTTAATAGAGCAGTTCGATG
TCTCCAGTGAGAGCTCCAGCATTGTAATAACAGTCAGGATCAGGCAGGTAGAATAATATT
TAATTAAAGTGTAATCTTAAAGAAAATAAAAGAATTAGTGTAATAAAGTAATTTGAGGAT
AAAAATAAACAGACAAGCAGAAATAAATTTAATTAGTATATTTTAATGAATATTTAGAAT
GCAAATATCAATTCTTATTCGCTAATAGAGATAAGTTATAATTTTAAAATTAATTAAAGA
ATCCCCAACAATTTTACCATTCATTTAATTATTATAAATAAATAAAAGAATTTAATCACG
TCATTTCTTAATTAAATAATTTACACTCTTTTTATTACTTAATAGAACCACAGAAAGGAA
TGTTTAGATTCAAGAATAAAATGGTGGATGTTCCCCCTTAAAGCAGCTTAGCAATTAAAA
CGAACCTTATTCTCCTATATCTCCTATTCGCACAAATTACTAAAAGTAGCAAAGTGCATC
TTCTTACAACTCCTAAATAAAGAGCATGAATTCGATTTAGGATTAACTTGCTTAGGCTAA
TGGTATTAATTCTTCATAAAAAAACATGTCTACAAGTAAGCAAAATATTTAACAATATCC
AAATCAACCTAAAAACTATCCTAGCTCTTTCCATAACTTGAACGCCTTTCCACAATAAGA
AAAAAATATTCAATCTTCTGAAGGAAACGAAAATCAAAATGTAAAGTAACCTGCATTGGT
AAATAACTTTGTTAAATAATCAAAAGATTAATCCCCTACAAAAACTGGATTATATAATGA
TAATAACTTCTATTAAGTATTAAATAACGTTTCTAATTACGACAAAGGTTTAGTTGTTGA
ATAGCAGTAGTAACAAAATCAGCTTAAATCATTTAACGATGAGTAGAAAAACTAACCTTT
TGGATACTCTTCAAACCAGTAAAAATAAAACTTTTAAGGACTCCCACCTCAAAGTTAAGC
TTCCTAGAATAGTTAATTCGGAGTACAAAGATAATACACAAATGAAACAGCAAGTAGCCC
TTAGTCTTCCTCTCCCACTATCGTTTAATTATAATCAGCATATTCTCAGTAAGGTTAAAA
TATTCCAGCCTTGCAAATTTAATAGAAACCAGAGCTTAAAGCAGAAGTTATGTTTAATAA
TATAAATAATGGCTAAGTATCGCCTTACAGATAGCAAGATGGTGCTGACAGAAAATTTTA
AGAACGAGGATTATTTTTACAGTAGGTGTAAGATTAATCTCCTGTTGCAACTAACCTTAA
TATTGAAAGTAAAAATAGTGGACTGTACTTATAGTAGCAGGTATCACAGCCTTATCAAAA
TAACACTAGTATTAGTAATAAGTAATAGGATAATTAAGGAGTTAACTTAGATTCAATGAA
TACAAACACATATAATAATTAAGGGAAGTTTGATGAATCACGCTTTAACTAAGTGTAGCT
TAAATAGTACTCTCTTTCTCATTAATATTCACTCAGCAGGTAAAACCAACCAGATTAAAA
TAATTAAGCAGCAACTCCTAATAGAAACATATCTCCTTAGAGTAAAAACTAAAGTGTATA
CACAAGCGAAAAGAATTCAAGTAGTGAATAAAGTCCTACCTCTTCTGTAAATCAATAAGC
TGGGTAATACATTCTCTAACAGCCTTAAACTTAATTTGTATAAAACCGCTATTCTCAAAA
TAATAATTCAAATTCAGCAAGTGGGTATTCCACAGTGATAAAAAGCGGAGACAATTCTTC
TAACCAAGATCAAGTAAATAGCAGATAAAATAGTCCATCGAACTATAATCCATCTAATAA
TTATTAACAGCAATAATAATAGTAAAATGTTTCTTTACAAAATCAATAAATTTAACAACT
GCAAGCAAATTAATAACAAATTTAAAAGCAAAGAAGTGGTGGAGATTCTCCAGATATTCG
TTATAAAGCCTACTCATTTACCGCTTCTAATGGATTGATAATGAATAAGAGTGGAGGTCT
CAATAACACAAATATATCCACAAGATCTATCACAGCTACAAATAATTCGAATTCTTCACC
TAAAAATAATGATTCAGAAGGTAAAATTTCATACAACTCTAACGGCTACCATTCTCAATA
GTAACAATAGTAGTAGTAATAACAAATAAATAACTCCAAAAACACATCAAGCAATCATGT
AATTTTTGGAAATCTCGATTAATAAGAGATTGGAGACTATAAAAACTAGAGACAAGCTCA
GTAAAATAGGTAAAACTTCATTTTATATTTTTCATTTTTTTTAGGTATAATTTTACAAAA
ACAAAAAATGCAAGTAAAAAAATTCAAACCACCCACTCTAAAAATTTAAATTCAAATATT
AAAGAAAATTTGAAATTGCCATTTGAATAATTTAAAACGGAGTGAAGAAGAAAGAGTAAT
AAATAATTGTATTTAAAATTACATAAATTAAGAGAAGCTAAATTAATCTATTTAATCTAA
AATATTTAAATGACTGGAAAAATTTAATTTAATTTAAGATGGTTTGAATATCTCAAAATA
GAATTTTATTAGCCAATACTTTTTGCATAGAAATATACTAATTAAAAATTTATTAGACTT
GAAAAAGCTTATTATTTGCATAACAACTTTGTATAACTATTTTATCAAGGCACTTTACAC
TTTTATTTGCGATTGATTTAGAGATTTTATTCAAAATTTTATTTACATATTTTAAAACAG
CGGCTAAAAAAAGGACTATGAGTCTGTAATCTAAATTCCATATGAATCTAATGGGAATAA
TCTAAATCACTAAAATATTCCATTTAACTACAAGAGGTCAATGACTCAAAACAATGAACA
TTAAGATTATGAATTAGACAATTACAAAAACACATATACCCCTAAAAACAACAGTGGTGC
ACATTCCTACGCCAACTTATAAAAGATGTAAGGCATATCTTAGAATGAATTCAGAAACAG
CAGTCCCAATTCAGTAGCACAGTTAATTGCTAAGAAAAATAGTGAATAAAATTAACTGCC
TAGATCCCCTCTAGAGAGAAGAAGAAAAAGTGAATTTGGAATTGGGTTATCAAATAAAAA
TTAAATTTATCAGAAGGAAATAAAGAATACTCCTTTCTAATAGTTTTCTTAAGCTTAATT
ACCAAACAACTCTCGCAATCAAATAACATTTTACACATCAAATACACAACAAGTTAAAAA
CCAATTTTTACAAAGTGAAGAAAACTATGGAAAAAATAATATCTTGAATTAAGCAGGCAA
TGTCTAAAACCCAGCAATCGTTTAGAATTAGTACAGCAGAAGCAGAAGCTTACACAATAA
TGCTGCAAGTAAATATAGTAACACTCACAATATTTCTCCAGCTAACACAGGAATTAGTCC
TAAAAATTCAAATAATTCATTATCTGATATCAAAAAAAAGCAGATCAATACTCAAGATTA
TTCCAAAATTCCCTCATAATTTTTCGGAAATAGTACTTCCCCAAAAGCTCAAACAAAGTA
TTAAGCATATCTGCAAAATACCTTGTAAGTTAAGAATTAATAATAAGGTGTTAATTAGCC
TACTAATTTAATAGTCTAAAAACATATATAACAATCAGGGAATGAACCTCAGTAAATGAA
TGAGATTTAAGGCAATTAGCAATTTAAGGAAATACAAAGAGAACCATCATAGTAGCTTAC
TGCTGATAACTCACCAAACAAGTATGCAAAATATGCTTTGAAAAATTATTTATTGTCTTA
AAATAACCAAGGTTCTAGTGCTGTAAATTATAACAACTCCAATATTTAAAATTAAAATAA
TACTTCTTCTTAAATGAACAGTAGTGGAAATAAGAATACTTAAAATTTAAATATTAATAG
CAAGACTTAAAATAGTCTAGATAATTTAGGATCTAATTAACCACAACAACAATAGTAAAT
ATTGAGAAATCAAAATTAGTATAGTTAAATAAATCCTCACCATCATGGACACAGTAAATC
GTTTTCAAATAACTTTAATTAACCAATAGTGTCTCTTAATTCTTAGTAAGAAATCACATA
AATTGAAAATACAAGCAATAATAACATGAATAGTAATAGTACTTAAAATGAGTTCTATGC
TTAGGACAATATGATAGAAAGTATACTTTGTATATGTAAGAGCGTTAGATTCTTGAAAAA
TTAAATAGATTACAACATCAAGAGCATTCTTAAGCTAGATGAACCATTTTTATATGAAAA
GTTAATATTCTTGTTGAATAAGCATCTTGTAATTCAGATTTCTATGCTTAAAATCACTTA
AATGGATAAAGGAATTAATGTAATTAACTTAGATAGATGGACTGAATACAGGGCAAGCCA
AAATTTTAATGAAGTTTATAAAAAAATTGCTTAAAACTACTACGATATAATTAGTACTCA
CTAGAATAATTGGAATCGTGCTCATGAAAATCAAAGATTTTATGATGAATCAAAAAAAGA
TTACTATTTTAGTAAAATATTTAACCAGTAATTAACACAGTATAATAGTCACACAAATAG
TGGGTAAAATTCTTCTAATAGCAATCCTCAAAATAATGAAGAAGATAACACTAATTTTTA
CTTTTACATTTACTAATTACTGAAGGAAATAATAAAAGAGGTGTTTAATAAATTGCAAAA
CAATCTATCAAAATATTTAGATTTAGACAATTCAAAGATTACTCGCGAAGACAGCCTTGT
TATAAACTGTTTAAGCAGACTTGTTGATTACCATCAATTGTTAAAATTAATTATATCATA
AAAAGAAGACTTCTCATTGATACTCAAGTCAATAAATATAACTGAATTTTTAAAAGAAAA
GATTATAACAATTGAGTTCTATGAAGCCCTCAAATAAAAAATGTATATATATGATTTAAT
AACAAAATGA