Identifiers and Description

Gene Model Identifier

TTHERM_00388490

Standard Name

MTSA2 (MethylTransferase targeting position N-Six of Adenine (MTSA) 2)

Aliases

PreTt24844 | 41.m00251 | MTA2

Description

MT-A70 family protein; potential function in re-methylating the progeny genome during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00388490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04475.19.997093137033517e-262MT-A70 family protein (1118 aa
)
OxytrichaContig17486.0.g1004.000899569014317e-153MT-A70
Stentor CoeruleusSteCoe_218053.4811068399043105e-57
SGDYGL192W2.999534586690157e-23IME4 Probable mRNA N6-adenosin
e methyltransferase required f
or entry into meiosis; transcr
ibed in diploid cells; haploid
s repress IME4 transcription v
ia production of antisense IME
4 transcripts; antisense trans
cription is repressed in diplo
ids

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000374

Sequences

>TTHERM_00388490(coding)
ATGTCAGAGGAAGATACGAGGTATCCTCATGAAAGCGCATTGAATAAAGGAAAGCATAAA
ATGGATGGTCTGCTTCGTGGGCTGGATCTAAATAATGTAGTTATAGAAAAACGCTCTAGA
AATAATTCAGAATCATCGCATTCCGTATCAGGGGAAGCTGCATCTAAAAAAAAATCAAAC
ACCACTTTATCTGACACAAGCAAAATAACTAAGCACAGGAAAAGTAGCAATGAAATTTAT
TTGGCAAAAGTAATCGAGGAATAGGAAGATTCATAAGAGGATAATCGTAAAGCAAATCAA
TAAAAAGATTTAAAAGAGGTTAAAGTAAAAAATTCTACAGAAGATTTAAATTCTTAGAGG
AGAAAATTGAGATCTTCAGGAATAGAAAAGTAAGATGAAATATCAAATATTAAAAGTAAA
AAGCATCAGAAAATTAATGCTAAAGTTACATAGCATACTGAAAAAATTATGAACTAAAAA
GTCTAGTAGGAGTAGAGTACATTTAATTTGAATAACTCGAACGAAGAAGGATTATCTTCA
ACTTCTTGCTCTTCAGATTTATTAAAAAAGACCAGAAATAAATCAAATTATGAGGTTGAA
GTACTCAGTTCTCATAAAAATCCTATTCATGTTTTAGGAAGTACTTTGAAAATTGAAAAG
CAGGTAGAAAAAAAAAGGAAAACTTCTGATTCTTAAAAAGTAGAGCCATCTGCTGAGTAA
TCTAAAGTAGTATCTAAAGAAAAATAAAAATCCTCTCAAAATAAAAAAGAAGAAGCTTAA
TTTCAGAGTCAAAAGTAAATGTTAGATAAAGGCAATGTATTTGGCTAAGAAAATTTTAGA
AAATCAACACGCTCAAATTCACTGAGTAGTGAATCTATTAGAAAACATAGTTCTGAAGAT
AATACAAATTCTTTGAAAAAGTAAGCACATAAAAAAAAGGATTTGTCGTCTACTCCTTTA
AAAAGTTAAAGTTAGAGAGATCTAAGAGCTTCAAAGAGAGAGATATTTAAAAATTAAGAA
TTGCAAGAACTTCAATAATTAGAAAAGATTTCATCAGAATAAAAATAAATTAAACAAACC
GATTAATTAAAAACTTTAAAAAAGTAAGATAACAACAAAGAAAATTTAGCTAGCAAAATA
GAAAATTAGAAATATAATTCCAATGAGCATACAATAAAAAAATAGGTTACATTCAAAGAA
AAATTAAGTGAGATAATAGGGGAAGAAGCAGAGTCTGCACCAGTTAAAGGAAGCTTTAAC
AACGCCTACGACTATAATGTTCATTAGGATTCTGATTCGGAAAAAGATTACTTTCCTTCT
AAAAAAGCATTAAAAAATCATAAGAAGGAGAAAAGAATTAAAAAAAGGTAAGAAAATAAA
TTAGAAATAGCAATTAAAAAAACTTAAAAACTCCTCAAAACTAAGAGTATGTAAATGAGG
CAATAAAGAACTATAATTAGTGTGGAAATTCCTTCTGAGTCATCTTTCGAAGATGATGAA
GATGAAGAGACTGCTGGGTAGAATCATAAAACAAACCATTTAAAAAATTAAAAAGTTGCA
TTTTTCTCAAAAAAATTAAATGATTTAGATAAAACAAATAGCTATAAATCAAAAAGAGAA
AAAGTTATTTAAGAGAATTGTTCTAGTTTGTAAATATAAGAAGGAAAAAAAAGTCAATAA
ATTTTAGAAATCTCAGACAATAGAAATGGAAAAAATAAGTCTAATGATGTTATGCTTACA
TCTTTATAGCAGAAAAATATAAAATCTTTATCTTTAGAAGCTTCTGGCTAAAAAAATTTA
AATAGCAATCTATAAATAAATTCTTAAGGTGTAGAGAATGAAGCTTAAACACAAAATGGC
AAAATAATTCAAAAAAATTAAAATGCATATGGCAAGAATAAAAATAGCGAAAGCAAGTCT
GGCAATAATAGTTTAGAAATTTAATCCTAAAAAAAAAATTTATAGATATAATAAATTCAT
TCTACTAATTAGTAAGTAAAAGCTGAGATTGAATTTAAAGATAAATAAATTAAGAAAAAA
CAATCTTTTACAACAAATCTTTAAAACTAAATGAATTTAAAAGATAAGCAATTTTAAAAC
ACAAATAATTTTAACTCAGAAATAGGAATTACCCAAAGAGAAAATAACTCAGACCAAAAC
GAAACCGACTTAAATCTAGAATAAAAAAATCTTAAGCGCTTAAACAATTTTAATACACCA
TTAGAAGGTTACCCAACGAATATATGCTCCTCCTCTTCTCTACTTATTATTGAGGAGGAT
AAGTTAGTAAAAGATGTAAATAACGATCCACATACTTTGAGCCAAGATTAGGCTAACTAA
TTTACCAATTAATAAGAATCATCTAAAACATAACTTATCCCTAAATGCGCTCATTAAGAT
GGCCAATAAAAACTATAAAATGAAGAAAATTTTTAACAATAAGAAGAAGACTATCAAGAT
AATTTTGCTAGTAATTCCTAATAAATAAGAAGTGCTGAACAAGATATTACAGGCTAAGTA
GAAGTAAATTAAACCTAATAAAAGAACATTTTCAGTTAATAAAGACAAATTTAGAATGAA
AATCGTAAAAGAGATGTAAGTAGCCCCTTCTTCTATGATCCTAAAATAGAATTTATAAAC
ACCAACATTTTCTTTAAAAACTTTTATACAGAGTTTCAACCATAAAATAGAAAAACCTTC
TATTAAAAAGTAGCATATTAACACCACTTATAAACTTACTCACTAACTTAGTAACATACT
CCCAGTTAGTAAACCCAATCTATTGTTTAATAAAGTTAGAAACCTGAAAGCAATAATCAA
ATCTAAGTTGTTTCTTAACAAAATGAATAATAAAAAGAAGAGTAATTGTTATAAGCAGAA
ATATAGGATGAGGAAAAATTACTCAAAGAGTAATTAAGTATTGAATAAAATTACTAAAAT
CATAGTAACTAATTGATTAGTATTGGCTAGAATGATAATTTTATAGAAAAAAATATTTGT
TAGGAAAATTCATAAGATTTAAATCAAACTAATAGCAAAGTCCAAAAAGACATTACTAGC
AATGAAATGCAAATTGAAAAGTAAGCATTAAGCTAATAAGCTTAATCAAACTTATAAAAT
GCCTAAGATGAGTAGAATTAAGAGCTAAAAAAGAAACATATTGGAATTTTAGCGGATAAA
AATAAGGAATCAGGCGAAAATATGGTTTAATTGCAATCTGAGCTAGACCTATTATATGAA
AAGTATTACCCAAGCTAAACTTATATAAATTGTGATTTGAAGTACTTTAACCTAGAATTG
ATAATTTAAAATACGGGATTATTTGATATTGTTTACATGGATCCTCCTTGGAGAATAAAA
GGTGGTTAGCAATTTGATAGTTAGTTCATGTTTTCTAATAGTAAATTTTCTTTGGATTAT
GATACAATGTCTAATAAAGAAATTATGGACATTCCAGTTGAGAGGTTATCAAACAAAGGT
TTCTTATTTTTATGGATTTTGAACACATAAATGAATACTGCTATATAGATGATGCAAAAA
TGGGGATACAACTTGGTTGATAAAATCGTGTGGGTTAAAATGAAAGATAAAAATGTTTAT
CTATCCCATGGATATTATTTTATGCATTCTTTTGAACTTTGTCTTATTGGATATAAGAAT
GATACCAAAGATGACCTTACTAGCATATATCCAGCATCAAACCCTTTTTCAGTTATAGAT
GAAAATATTTTAGAAGAAAACAAGTCGAAAGGAGGCAACAAGAAAAGTGAAATAAACTTG
GAATACCCTCATTTTTTTAACAAAATTTCTAACAATGTCATCTTTGCCGAAGTTAGAAAG
AAATCGCAGAAGCCTGATGAAATTTATGAAATTATAGATCTATTAATACCCGGAGCTAAA
AAAATTGAATTATTTGCTCGTAATAATAATTTGCGTCCAGGCTGGGTAAGTGTTGGCAAC
TAACTAGGTGAAACTTACGAAAAATGGATGCATTAAGTAAATTGTGATAACTGTCACTAG
GAAATTGTAAAGGGAAAGCTAAAAAGATATAAGTCTCGTAGGATAAATAATTATGATATA
TGCGAAAATTGTGTGTTGAATTTTGATAAGAAAGATTTTTATGAAATACAAAACAAAGTA
AATGAGGATATTTTGCATAATTATCAAAGTTGTAATCGTTGTGAAGCTGAACCAATATGG
GGAATCAGATTCCATTGTATGATTTGCAAAGATTTTGATTTATGTGAAGCTTGTGTAGAT
GAAAATACGAAGTTATGTGAAGAAGAGTAGTTCCATAACTTGCAACATGACATGAAAATT
ATCGAAGTGCCAGTATTTGCAGATGGATTTCCTGTTCATGATAGAAAATGTTAATCTTGC
TTTATGAGCCCGATCATAGGCACTTGTTTTACATGCAAGTAATGCTAAGGGAACTTTAAT
CTTTGTTAGAACTGTTATTTTAGCAAGCCAATAGAGACCATTAAAAACAAAAGACATAGA
CCAGAACATTAAATGGATGCACTTATAAGTCCAGTCAAAAATACTAAAACTAAAAAGATT
TAGTTTAAATGTGCAGGATGTGGAGTTTTAAATTTAAAAGATATGTACAAGTGTGAAAAC
TGTTATGGTTTTTATTTCTGTCTATCATGTTATGAGACTAAATGCGATGATTTTAAAACT
TACATGGCGAGTTCCCATAAAAATTACCATTCACTTATTAGATATAATCTTGAAGAAATT
GAGAGTTAGAACGAATAGAAAGTTGAACTGCAAGATGCTTAGGCTTAGTAGATCAACAAC
GATCCTATAAATAGTCAACTTATACTTAATGTTATATCTCAAATCTTAGACACAGATGAA
GTCAATAAACCATAAAATATTGATAATTATGCTGAAGAAGGGAGATAAGACTAATTAAAA
GAATTGAATTAGAAATAAATTGATGAAGATGAAGATAATATCCTAAAAAATAAAACAGAA
ATATAAGAAGAGTCTAGAAATATTAATTAAGACACTAAAAATAAAAAAAATGGCTAAACT
AAAAGACCCTATAATAGAAAGTAAAAAGTTAAATCAATAGAAGACAAAGATGAGACCAAT
TTGGATAAATAAAATAATAATTAAGTTGAATTATAAAATGATAAATAAAATGAGTAATTA
AATATTGAATAAGATTAATCAGGAAATTAAAATATGAATCAGCTAAAGGAAGATCAAGAT
GAGTTGGAAAAGGCTGAAGAATAAAATTTAAAAAGCAATTTAGTGAAAAAAATAAGAAAA
AAAAGGGTGAGTAAGAAATAAAAATAATAACTAGAAGATTAAAGTGAGGAAAAAAAAGAA
GAAAATAATGACTAATTAATTGATAAGAAGTCCGACTCAATTAACAATGAAAACAAAAGT
GTAGACGAGTCTAAATAAAATTAGATGGAAGAGGAAGAAGATTAAAAAGAGGAAAGCAAT
AAAAATGAAGATGATAAAGAGGAGAATGAAATACAAGAAGAAAATAAAGTTGTTAAGAAA
AGGAAAAGAAGAACTAAAGAAGAGATAGAAAAATTCAAACAAGAAAAAGAATAAAAAAAT
TTGGAGTACTTGATCGGTCTACAAGATGGTAAAGAAAAGAAAAAAAGAGGAAGACTTCCT
AAATTAAAAGATAATTCCAAACTGTAAGTATTGTTGAATAGTTAAATAGAATAAAATTAA
CAACAAAAGTAATCAGATGAAAACTCATTTTTGTAAATAAACTAATCAAATATAAATGAA
TAATTTTTTGATAAGCAGCATAATGAATACAACCAAAAACTCATATAAGATTAACTATTG
TTAGAAACCTTATCAAATTAACCATCACAAATTGTAACAGAGTTGTAATATAAACTGAAG
CTTTTAGAGTCTTATTAATAATAAAAAGTTGTTTCCGAAAATGAAAATACTAAGCTTAAT
AATAGTAATAATGATATATACTTTTTATCAGATATCAACTAAGCTTCAGACTCTAAAGAG
AATACTCTCCATTTTTAAATCTAAAACTAATTAAATAAAAATAAAATTTCAAATTTTAAT
TACTCTAACTAAGAGGATTAACAAATTTAAAATCCATTTGACTATGACTTACTATAAAAC
CTATTAAATTCAATAAATAGAAACTCTCTATAATAATCAAACCACTCTTACAATGAAGAA
AATACAATTCAATATAATAATAATTCTGTTGAAAAAATAATTTAAGATGTCAAAGAAAAT
TAACAAAAAGAAAACTTAATTGGCCAAGTCAATCAAGAATAGATTAATTAAGAAGACTAA
AATGATGATGAATCATATGATTCGTCTAGCTCTTCAAGTTGA


>TTHERM_00388490(protein)
MSEEDTRYPHESALNKGKHKMDGLLRGLDLNNVVIEKRSRNNSESSHSVSGEAASKKKSN
TTLSDTSKITKHRKSSNEIYLAKVIEEQEDSQEDNRKANQQKDLKEVKVKNSTEDLNSQR
RKLRSSGIEKQDEISNIKSKKHQKINAKVTQHTEKIMNQKVQQEQSTFNLNNSNEEGLSS
TSCSSDLLKKTRNKSNYEVEVLSSHKNPIHVLGSTLKIEKQVEKKRKTSDSQKVEPSAEQ
SKVVSKEKQKSSQNKKEEAQFQSQKQMLDKGNVFGQENFRKSTRSNSLSSESIRKHSSED
NTNSLKKQAHKKKDLSSTPLKSQSQRDLRASKREIFKNQELQELQQLEKISSEQKQIKQT
DQLKTLKKQDNNKENLASKIENQKYNSNEHTIKKQVTFKEKLSEIIGEEAESAPVKGSFN
NAYDYNVHQDSDSEKDYFPSKKALKNHKKEKRIKKRQENKLEIAIKKTQKLLKTKSMQMR
QQRTIISVEIPSESSFEDDEDEETAGQNHKTNHLKNQKVAFFSKKLNDLDKTNSYKSKRE
KVIQENCSSLQIQEGKKSQQILEISDNRNGKNKSNDVMLTSLQQKNIKSLSLEASGQKNL
NSNLQINSQGVENEAQTQNGKIIQKNQNAYGKNKNSESKSGNNSLEIQSQKKNLQIQQIH
STNQQVKAEIEFKDKQIKKKQSFTTNLQNQMNLKDKQFQNTNNFNSEIGITQRENNSDQN
ETDLNLEQKNLKRLNNFNTPLEGYPTNICSSSSLLIIEEDKLVKDVNNDPHTLSQDQANQ
FTNQQESSKTQLIPKCAHQDGQQKLQNEENFQQQEEDYQDNFASNSQQIRSAEQDITGQV
EVNQTQQKNIFSQQRQIQNENRKRDVSSPFFYDPKIEFINTNIFFKNFYTEFQPQNRKTF
YQKVAYQHHLQTYSLTQQHTPSQQTQSIVQQSQKPESNNQIQVVSQQNEQQKEEQLLQAE
IQDEEKLLKEQLSIEQNYQNHSNQLISIGQNDNFIEKNICQENSQDLNQTNSKVQKDITS
NEMQIEKQALSQQAQSNLQNAQDEQNQELKKKHIGILADKNKESGENMVQLQSELDLLYE
KYYPSQTYINCDLKYFNLELIIQNTGLFDIVYMDPPWRIKGGQQFDSQFMFSNSKFSLDY
DTMSNKEIMDIPVERLSNKGFLFLWILNTQMNTAIQMMQKWGYNLVDKIVWVKMKDKNVY
LSHGYYFMHSFELCLIGYKNDTKDDLTSIYPASNPFSVIDENILEENKSKGGNKKSEINL
EYPHFFNKISNNVIFAEVRKKSQKPDEIYEIIDLLIPGAKKIELFARNNNLRPGWVSVGN
QLGETYEKWMHQVNCDNCHQEIVKGKLKRYKSRRINNYDICENCVLNFDKKDFYEIQNKV
NEDILHNYQSCNRCEAEPIWGIRFHCMICKDFDLCEACVDENTKLCEEEQFHNLQHDMKI
IEVPVFADGFPVHDRKCQSCFMSPIIGTCFTCKQCQGNFNLCQNCYFSKPIETIKNKRHR
PEHQMDALISPVKNTKTKKIQFKCAGCGVLNLKDMYKCENCYGFYFCLSCYETKCDDFKT
YMASSHKNYHSLIRYNLEEIESQNEQKVELQDAQAQQINNDPINSQLILNVISQILDTDE
VNKPQNIDNYAEEGRQDQLKELNQKQIDEDEDNILKNKTEIQEESRNINQDTKNKKNGQT
KRPYNRKQKVKSIEDKDETNLDKQNNNQVELQNDKQNEQLNIEQDQSGNQNMNQLKEDQD
ELEKAEEQNLKSNLVKKIRKKRVSKKQKQQLEDQSEEKKEENNDQLIDKKSDSINNENKS
VDESKQNQMEEEEDQKEESNKNEDDKEENEIQEENKVVKKRKRRTKEEIEKFKQEKEQKN
LEYLIGLQDGKEKKKRGRLPKLKDNSKLQVLLNSQIEQNQQQKQSDENSFLQINQSNINE
QFFDKQHNEYNQKLIQDQLLLETLSNQPSQIVTELQYKLKLLESYQQQKVVSENENTKLN
NSNNDIYFLSDINQASDSKENTLHFQIQNQLNKNKISNFNYSNQEDQQIQNPFDYDLLQN
LLNSINRNSLQQSNHSYNEENTIQYNNNSVEKIIQDVKENQQKENLIGQVNQEQINQEDQ
NDDESYDSSSSSS


>TTHERM_00388490(gene)
ATGTCAGAGGAAGATACGAGGTATCCTCATGAAAGCGCATTGAATAAAGTAGGCAATTTT
AATTTACATAAATATATCATGCAAATATTCATTTTCATAATTAGAAGAAGTTTTTTAAAG
CTTAAAAGAAATTATTTAAGTATAAAAGTTGACATTTTTAAATTTTTATCAAGGGAAAGC
ATAAAATGGATGGTCTGCTTCGTGGGCTGGATCTAAATAATGTAGTTATAGAAAAACGCT
CTAGAAATAATTCAGAATCATCGCATTCCGTATCAGGTAGAACATTTTAACAATAATTTA
AACTTGTTCATTTTTAATCGTGCATTTTTCTTAGCAAAATAAAGATAAAATAAGAAAAGG
AAAATTTAAATTTTTTAAGTTTATTTTTTTATTGCATCTTTTTTAAAAAACTGATATATA
TTCATAATAAAAAGGGGAAGCTGCATCTAAAAAAAAATCAAACACCACTTTATCTGACAC
AAGCAAAATAACTAAGCACAGGAAAAGTAGCAATGAAATTTATTTGGCAAAAGTAATCGA
GGAATAGGAAGATTCATAAGAGGATAATCGTAAAGCAAATCAATAAAAAGATTTAAAAGA
GGTTAAAGTAAAAAATTCTACAGAAGATTTAAATTCTTAGAGGAGAAAATTGAGATCTTC
AGGAATAGAAAAGTAAGATGAAATATCAAATATTAAAAGTAAAAAGCATCAGAAAATTAA
TGCTAAAGTTACATAGCATACTGAAAAAATTATGAACTAAAAAGTCTAGTAGGAGTAGAG
TACATTTAATTTGAATAACTCGAACGAAGAAGGATTATCTTCAACTTCTTGCTCTTCAGA
TTTATTAAAAAAGACCAGTAAAATACTTGAAAATTTAATTCAAAATACCTATATTTTAAA
TAAAATCAACCTATTTCTACTCTAAACCCTTAATTAATTAAGAATTTATAAATAAATAAC
ACTTAGAATAATATTTATGCTTTCTTAAATTAAATTAAGATTTTGTCAAACAAAATTTTA
TAATTTTATATCTTATCAAAATTTCCGAATTCTGCCATCAATAAATATAATTTATGCTAA
ATAAAAAGGAAATAAATCAAATTATGAGGTTGAAGTACTCAGTTCTCATAAAAATCCTAT
TCATGTTTTAGGAAGTACTTTGAAAATTGAAAAGCAGGTAGAAAAAAAAAGGAAAACTTC
TGATTCTTAAAAAGTAGAGCCATCTGCTGAGTAATCTAAAGTAGTATCTAAAGAAAAATA
AAAATCCTCTCAAAATAAAAAAGAAGAAGCTTAATTTCAGAGTCAAAAGTAAATGTTAGA
TAAAGGCAATGTATTTGGCTAAGAAAATTTTAGAAAATCAACACGCTCAAATTCACTGAG
TAGTGAATCTATTAGAAAACATAGTTCTGAAGATAATACAAATTCTTTGAAAAAGTAAGC
ACATAAAAAAAAGGATTTGTCGTCTACTCCTTTAAAAAGTTAAAGTTAGAGAGATCTAAG
AGCTTCAAAGAGAGAGATATTTAAAAATTAAGAATTGCAAGAACTTCAATAATTAGAAAA
GATTTCATCAGAATAAAAATAAATTAAACAAACCGATTAATTAAAAACTTTAAAAAAGTA
AGATAACAACAAAGAAAATTTAGCTAGCAAAATAGAAAATTAGAAATATAATTCCAATGA
GCATACAATAAAAAAATAGGTTACATTCAAAGAAAAATTAAGTGAGATAATAGGGGAAGA
AGCAGAGTCTGCACCAGTTAAAGGAAGCTTTAACAACGCCTACGACTATAATGTTCATTA
GGATTCTGATTCGGAAAAAGATTACTTTCCTTCTAAAAAAGCATTAAAAAATCATAAGAA
GGAGAAAAGAATTAAAAAAAGGTAAGAAAATAAATTAGAAATAGCAATTAAAAAAACTTA
AAAACTCCTCAAAACTAAGAGTATGTAAATGAGGCAATAAAGAACTATAATTAGTGTGGA
AATTCCTTCTGAGTCATCTTTCGAAGATGATGAAGATGAAGAGACTGCTGGGTAGAATCA
TAAAACAAACCATTTAAAAAATTAAAAAGTTGCATTTTTCTCAAAAAAATTAAATGATTT
AGATAAAACAAATAGCTATAAATCAAAAAGAGAAAAAGTTATTTAAGAGAATTGTTCTAG
TTTGTAAATATAAGGTAAAGATAATAAATAATATACCTTAATTTTATTTTTTTAATTTAT
TTCAATCTAATTAATAGAAGGAAAAAAAAGTCAATAAATTTTAGAAATCTCAGACAATAG
AAATGGAAAAAATAAGTCTAATGATGTTATGCTTACATCTTTATAGCAGAAAAATATAAA
ATCTTTATCTTTAGAAGCTTCTGGCTAAAGTAATTACATTATTTTCTTCAAAGCATTGGT
TACTAATTATTTTTTAATTTTTAATTGTATAAAAAGAAAATTTAAATAGCAATCTATAAA
TAAATTCTTAAGGTGTAGAGAATGAAGCTTAAACACAAAATGGCAAAATAATTCAAAAAA
ATTAAAATGCATATGGCAAGAATAAAAATAGCGAAAGCAAGTCTGGCAATAATAGTTTAG
AAATTTAATCCTAAAAAAAAAATTTATAGATATAATAAATTCATTCTACTAATTAGTAAG
TAAAAGCTGAGATTGAATTTAAAGATAAATAAATTAAGAAAAAACAATCTTTTACAACAA
ATCTTTAAAACTAAATGAATTTAAAAGATAAGCAATTTTAAAACACAAATAATTTTAACT
CAGAAATAGGAATTACCCAAAGAGAAAATAACTCAGACCAAAACGAAACCGACTTAAATC
TAGAATAAAAAAATCTTAAGCGCTTAAACAATTTTAATACACCATTAGAAGGTTACCCAA
CGAATATATGCTCCTCCTCTTCTCTACTTATTATTGAGGAGGATAAGTTAGTAAAAGATG
TAAATAACGATCCACATACTTTGAGCCAAGATTAGGCTAACTAATTTACCAATTAATAAG
AATCATCTAAAACATAACTTATCCCTAAATGCGCTCATTAAGATGGCCAATAAAAACTAT
AAAATGAAGAAAATTTTTAACAATAAGAAGAAGACTATCAAGATAATTTTGCTAGTAATT
CCTAATAAATAAGAAGTGCTGAACAAGATATTACAGGCTAAGTAGAAGTAAATTAAACCT
AATAAAAGAACATTTTCAGTTAATAAAGACAAATTTAGAATGAAAATCGTAAAAGAGATG
TAAGTAGCCCCTTCTTCTATGATCCTAAAATAGAATTTATAAACACCAACATTTTCTTTA
AAAACTTTTATACAGAGTTTCAACCATAAAATAGAAAAACCTTCTATTAAAAAGTAGCAT
ATTAACACCACTTATAAACTTACTCACTAACTTAGTAACATACTCCCAGTTAGTAAACCC
AATCTATTGTTTAATAAAGTTAGAAACCTGAAAGCAATAATCAAATCTAAGTTGTTTCTT
AACAAAATGAATAATAAAAAGAAGAGTAATTGTTATAAGCAGAAATATAGGATGAGGAAA
AATTACTCAAAGAGTAATTAAGTATTGAATAAAATTACTAAAATCATAGTAACTAATTGA
TTAGTATTGGCTAGAATGATAATTTTATAGAAAAAAATATTTGTTAGGAAAATTCATAAG
ATTTAAATCAAACTAATAGCAAAGTCCAAAAAGACATTACTAGCAATGAAATGCAAATTG
AAAAGTAAGCATTAAGCTAATAAGCTTAATCAAACTTATAAAATGCCTAAGATGAGTAGA
ATTAAGAGCTAAAAAAGAAACATATTGGAATTTTAGCGGATAAAAATAAGGAATCAGGCG
AAAATATGGTTTAATTGCAATCTGAGCTAGACCTATTATATGAAAAGTATTACCCAAGCT
AAACTTATATAAATTGTGATTTGAAGTACTTTAACCTAGAATTGATAATTTAAAATACGG
GATTATTTGATAGTAAAAAATTAATTAATTATTTATTTATTTATTCAATTATTAAAGAAA
GAAATTAATTATTTCAGAGAATAAAAATTAGAGGGAGAGAGAAGAAAGGAATAATTAAAT
TTTATTTTATTTATGAATTTTCACAATCTGCTTAATTTATTTTTTACCCTTTTTTAAATT
TTCTATTTAGAAGCTAAATTTTCATAAATTTAAAAAGTCTTAAAAAATTTTATAAAAAAT
AAAACGTATTTATTTTATTAATTATAAAATTGTTTTAAAATAGTTGTTTACATGGATCCT
CCTTGGAGAATAAAAGGTGGTTAGCAATTTGATAGTTAGTTCATGTTTTCTAATAGTAAA
TTTTCTTTGGATTATGATACAATGTCTAATAAAGAAATTATGGACATTCCAGTTGAGAGG
TTATCAAACAAAGGTTAGTTTTTATAATATCTATTCTTTTTCTTTAGGATTATTTCCTAG
ATTTTTGATTATGTATGAATTGGTTTACTTACTATATTCTTATTATTTTAGGTTTCTTAT
TTTTATGGATTTTGAACACATAAATGAATACTGCTATATAGATGATGCAAAAATGGGGAT
ACAACTTGGTTGATAAAATCGTGTGGGTTAAAATGAAAGATAAAAATGTTTATCTATCCC
ATGGATATTATTTTATGCATTCTTTTGAACTTTGTCTTATTGGATATAAGAATGATACCA
AAGATGACCTTACTAGCATATATCCAGCATCAAACCCTTTTTCAGTTATAGATGAAAATA
TTTTAGAAGAAAACAAGTCGAAAGGAGGCAACAAGAAAAGTGAAATAAACTTGGAATACC
CTCATTTTTTTAACAAAATTTCTAACAATGTCATCTTTGCCGAAGTTAGAAAGAAATCGC
AGAAGCCTGATGAAATTTATGAAATTATAGATCTATTAATACCCGGAGCTAAAAAAATTG
AATTATTTGCTCGTAATAATAATTTGCGTCCAGGCTGGGTAAGGTAAAATGAAATAATTA
GAAGAATAAAAATTAAAATAAGTTATTTTTTACCCACTAAGAATAGAAATCATAAATATT
TAAATTTTAACAAGTTATAATTTGAGCAAAATAAATAAAATCTATCTATATTAAATAAAA
CATTCTGTCTTGAGAGACAATTTTTCTTAAAAATATTAAAATAATCATCTTTTTTTTATT
TTAAGCATTGTTTTATGAAAATCTACTTACTTAAATATTATTTTCAAACTAAATTAGTGT
TGGCAACTAACTAGGTGAAACTTACGAAAAATGGATGCATTAAGTAAATTGTGATAACTG
TCACTAGGAAATTGTAAAGGGAAAGCTAAAAAGATATAAGTCTCGTAGGATAAATAATTA
TGATATATGCGAAAATTGTGTGTTGAATTTTGATAAGAAAGATTTTTATGAAATACAAAA
CAAAGTAAATGAGGATATTTTGCATAATTATCAAAGTTGTAATCGTTGTGAAGCTGAACC
AATATGGGGAATCAGATTCCATTGTATGATTTGCAAAGATTTTGATTTATGTGAAGGTAA
AATAATTTAAAAGTTACCCTTATTTTAATTTTTAAAAATCAGTATCCTCATCAATTTTTT
TAAATTAAAAAGCTTGTGTAGATGAAAATACGAAGTTATGTGAAGAAGAGTAGTTCCATA
ACTTGCAACATGACATGAAAATTATCGAAGTGCCAGTATTTGCAGATGGATTTCCTGTTC
ATGATAGAAAGTAAAAAGATCTAAAAATTTTAATTGATTATGTTAACTTTAAATTTTTTA
TTTTAATATTTATTATCTAATTTAGATGTTAATCTTGCTTTATGAGCCCGATCATAGGCA
CTTGTTTTACATGCAAGTAATGCTAAGGGAACTTTAATCTTTGTAAATATTTTATAATTT
TAGCTTTATACTTAATGATTTTTGCTATTATTTTAAAGGTTAGAACTGTTATTTTAGCAA
GCCAATAGAGACCATTAAAAACAAAAGACATAGACCAGAACATTAAATGGATGCACTTAT
AAGTCCAGTCAAAAATACTAAAACTAAAAAGATTTAGTTTAAATGTGCAGGATGTGGAGT
TTTAAATTTAAAAGATATGTACAAGTGTGAAAACTGTTATGGTTTTTATTTCTGTCTATC
ATGTTATGAGACTAAATGCGATGATTTTAAAACTTACATGGCGAGTTCCCATAAAAATTA
CCATTCACTTATTAGATATAATCTTGAAGAAATTGAGAGTTAGAACGAATAGAAAGTTGA
ACTGCAAGATGCTTAGGCTTAGTAGATCAACAACGGTAATAAATGCTTATGAAATAATTT
AAAAATAATATTTTTTTTATTTAGATCCTATAAATAGTCAACTTATACTTAATGTTATAT
CTCAAATCTTAGACACAGATGAAGTCAATAAACCATAAAATATTGATAATTATGCTGAAG
AAGGGAGATAAGACTAATTAAAAGAATTGAATTAGAAATAAATTGATGAAGATGAAGATA
ATATCCTAAAAAATAAAACAGAAATATAAGAAGAGTCTAGAAATATTAATTAAGACACTA
AAAATAAAAAAAATGGCTAAACTAAAAGACCCTATAATAGAAAGTAAAAAGTTAAATCAA
TAGAAGACAAAGATGAGACCAATTTGGATAAATAAAATAATAATTAAGTTGAATTATAAA
ATGATAAATAAAATGAGTAATTAAATATTGAATAAGATTAATCAGGAAATTAAAATATGA
ATCAGCTAAAGGAAGATCAAGATGAGTTGGAAAAGGCTGAAGAATAAAATTTAAAAAGCA
ATTTAGTGAAAAAAATAAGAAAAAAAAGGGTGAGTAAGAAATAAAAATAATAACTAGAAG
ATTAAAGTGAGGAAAAAAAAGAAGAAAATAATGACTAATTAATTGATAAGAAGTCCGACT
CAATTAACAATGAAAACAAAAGTGTAGACGAGTCTAAATAAAATTAGATGGAAGAGGAAG
AAGATTAAAAAGAGGAAAGCAATAAAAATGAAGATGATAAAGAGGAGAATGAAATACAAG
AAGAAAATAAAGTTGTTAAGAAAAGGAAAAGAAGAACTAAAGAAGAGATAGAAAAATTCA
AACAAGAAAAAGAATAAAAAAATTTGGAGTACTTGATCGGTCTACAAGATGGTAAAGAAA
AGAAAAAAAGAGGAAGACTTCCTAAATTAAAAGATAATTCCAAACTGTAAGTATTGTTGA
ATAGTTAAATAGAATAAAATTAACAACAAAAGTAATCAGATGAAAACTCATTTTTGTAAA
TAAACTAATCAAATATAAATGAATAATTTTTTGATAAGCAGCATAATGAATACAACCAAA
AACTCATATAAGATTAACTATTGTTAGAAACCTTATCAAATTAACCATCACAAATTGTAA
CAGAGTTGTAATATAAACTGAAGCTTTTAGAGTCTTATTAATAATAAAAAGTTGTTTCCG
AAAATGAAAATACTAAGCTTAATAATAGTAATAATGATATATACTTTTTATCAGATATCA
ACTAAGCTTCAGACTCTAAAGAGAATACTCTCCATTTTTAAATCTAAAACTAATTAAATA
AAAATAAAATTTCAAATTTTAATTACTCTAACTAAGAGGATTAACAAATTTAAAATCCAT
TTGACTATGACTTACTATAAAACCTATTAAATTCAATAAATAGAAACTCTCTATAATAAT
CAAACCACTCTTACAATGAAGAAAATACAATTCAATATAATAATAATTCTGTTGAAAAAA
TAATTTAAGATGTCAAAGAAAATTAACAAAAAGAAAACTTAATTGGCCAAGTCAATCAAG
AATAGATTAATTAAGAAGACTAAAATGATGATGAATCATATGATTCGTCTAGCTCTTCAA
GTTGA