Identifiers and Description

Gene Model Identifier

TTHERM_00387050

Standard Name

LIG4 (DNA ligase IV)

Aliases

PreTt24799 | 41.m00206

Description

DNA ligase required for nonhomologous end-joining (NHEJ)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02776 ) DNA ligase D
  • ( PF04675 ) DNA ligase N terminus
  • ( PF01779 ) ribosomal L29e protein family
  • ( PF00533 ) BRCA1 C Terminus (BRCT) domain
  • ( PF01068 ) ATP-dependent DNA ligase domain
  • ( TIGR00574 ) DNA ligase I, ATP-dependent (dnl1)
  • ( TIGR02779 ) DNA polymerase LigD, ligase domain
  • ( PF01331 ) mRNA capping enzyme, catalytic domain
  • ( PF04679 ) ATP dependent DNA ligase C

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04427.19.997093137033517e-262DNA ligase IV (1028 aa)
OxytrichaContig17485.0.g1016.001048086731027e-152ATP dependent DNA ligase domai
n
DictyBaseDDB_G02927609.995094197784295e-101lig4 on chromosome: 6 position
2052081 to 2055347
SGDYOR005C9.998397555368434e-52DNL4 DNA ligase required for n
onhomologous end-joining (NHEJ
), forms stable heterodimer wi
th required cofactor Lif1p, in
teracts with Nej1p; involved i
n meiosis, not essential for v
egetative growth
WormBaseWBGene000029852.0003218023735366e-33locus:lig-1 DNA ligase 1 s
tatus:Partially_confirmed Un
iProt:Q27474 protein_id:CAA9
8242.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00387050(coding)
ATGCAAAACTATTATAAATGGCATAAGATAAAATAAGAATAAAATCAAGAATTGTCTGTT
AATATAAAGCCAATTTCTTCATCAAAGATGAAACAAAGTGATATTTCTACTAGGAAGAAA
AAAGCTTAAGAGTATAATATGGATTTTGATGAATTTTAGCAAGAGGATTCTAAAATTAAC
TAAAATTCTGATAATTTTCACTTTGGTGATTCAGCAGATGAATATGGTATTGATTCACCA
AAAATGAAAAGAGAAAAAGCAGTTAAAGAAGAAGATAATACCTTTCGCTTAGAAATTAAA
AAATCTCCTATCCTAGAGAAAACACTCTTTTCATTTTTAGTCAAATTTTATAATTAAGTC
TAGCAATCTAAAAAAGGGCAAAGAAAAAAATTTGTATAAAGATTCATTGACTCTACATTT
AAAACAAATAGATGTCCATCTTACACATTTACTATCCTTAGGTTAATAATGCCTCATCAT
GATAAATAACGTCTTAATTATGGCTTAAACTATAAAAATTTAGCTAAAGTTTTAAGCGAA
GTGTTTGCCTTATCAGAAGATAAACGTCAATAGCTTTTGAATTATAAAAGACCTTTAAAA
GACAACTAGCAAGTAGTTGGTGATTTTGGTGAAGTTGTATAAAATGTTTTGTAAGCATTT
ACTTAGAAAGCCACACTAACAATCAACGATGTGGATAGATGTCTTGATGAGCTTGCATAA
CCTCAAAATAGAGATCTAGCATCCAAAGAAAAAGTTTTAAGAAACTGCTTGAAGAATGCA
ACATCAGAAGAAATAAAATGGATTTCACGTTTGATCTTAAAGGACCTTAATCTTGGTATT
AATCACGAAATAATACTTGCACTTTTTCATCCTGATGCAGTAGTATTATTTAATTCTACT
TCTAGTCTTTGGGAGGTTTGCAAGGAATTTGTAGATCCAAATCATAAATTATCTAATGTC
CTTAGGCTATTTCATCCTATAAAACCTATGCTTGCAGGACGTAAGACTCTCAAAAGTATT
GAAGCTATTCTTAAAGGTAAAAACTATTTAGTTGAAACAAAATTTGATGGGGAGAGAATT
TAGTGTCATGTATCTCCTGAATCTTTAATGTTTTTCACTAGAAACTCAAACAATTATACA
AATATTTATGAAAGAATGATAGAGCATGTTAGAAGAAGTTTAAAAGATGCTGTTCATAGT
TGTATTTTAGATGGAGAAATGGTTGTAGTAAATAAAATAACAGGATAAAGAGTTTAATTT
GGTCTTAATAAAACTGTTGCAATGGAAAGAGAGGATGATGAATTATGTATATGTTATAAA
ATTTTTGACATTTTATATTTGAAGACTAAAGATAATAAAGAATATGCACTGACAGAATAC
ACATTGCAATATAGAAAAAAAATTTTAGAAAATTTAATTGACAATCAATAAGACAGAGTT
GAAGTTATTTTTGGTAGAGAATACTCAGATATAAATGACATACTGACTGAATTTAATGAG
GCAATACATAGAAACGATGAAGGTATAGTCATAAAGCAGCTCGATACTCTGTATTACCCA
GATGATAGATCTGATAAGTGGATTAAAATGAAAGGTGACTACTATGAAGGAATAATAGAT
ACCTTAGATTTGATAGTTATTGGAGGATATTTTGGTGAAAAGTCTTATAAAATTAATGGC
ATAGGAGATTGGACAGATCATATCACACATTATCTTGTTGCTGTAGCGAAAAAGATTGAT
CTACAAAACCCCTCTAACTCTATACTTGTGCCTTTTGCTAAAGTGGGAGCAGGTTTTACA
GCTAGAGACTATGCTGATATAAAAGCTAGAATGAGAGATCAATGGGTAAGAACTAATCAT
TCAAATAAAACGCCTTCTTTCATCATATAAAACTGGAAACCTGGAGAAAAAGATAAGCCA
GATGCATATATTTTATCTCCTCAAAACTCTCTTATTTTAGAGATTAGGGCAACTGAAATT
ATATAATCTTCTTAATATCCGACCAACTACACCTTAAGATTTCCGAGATTTGAAAAATTT
AGAAGAGATAAAGATTGGTTTGATTGCATGAAATTTAATGAAATTATAGAAATGACTTAA
AATTTAAAGAAAAAAGAATAAAAAGAGAGTGACAAAGAAGATAATGCAAGCGATGAAGAG
TAGGACGAAAATGGAGGAAAATTAAAGAAAAAAAGAAAAGGGTAAAATGGAGAAGAGATA
GAAGTAAATAGACAAGGTAGAAAGCCAAACTGGAAGACCAATAAAGTTATGGCTCAATAT
CTTGATATTGATGTTTCTGATGTCAAAGTAGAATCAAATATATTTAATAACTTTGTATTT
AATATAATTAATTTACCTCATGAAGTATCCTTGAGTGAGGAAAAGATATTGTTAGAGAAA
GCCTAGATTGAAAAAGGTATAGTTGCTAATGGTGGTAAAAAAGTATAAAATGATAGCAAT
CTTGTAACTCATTACATAGCTTCACATTATGATTTTAAAGTTTAAGTAATTGGTGATCAC
TATAAAGTAAATGTTCTATCCTTATAATGGGTAAAAGACTGTATCAAAAAAAAAACTTTA
TTAGATTACTCTCCCCGCTACATTATATATGGTTAAGATTAATTGCTTGAGAGAAATAAA
TTGCTTTATGATTAATATGGAGATTCTTATTACAAAGATGTTGATGAAGATGAGTTATTG
GATATTTTAAAATCTATGAAAATTGATTAAATAGAAGAAGAATTCTAGGAGAATGAAGAG
TTTGAAGAGGCTGTTAAAGATATTATTTCCATGAAAAACCAACTTTTCAAAGAATGTTTT
CCGTAAGGATAAACTTATTGCTTTTATAATGCAAATGATAAATTGAATTCAGATATAGAC
TTAAGATATTTAGTTGATCTAATTTAATTTAGTGGAAATTAAGTTGTATTTGACTTATAG
GACGAAATTGATTACATAGTGGCTTTAGATTATAGTGAAGCTGAAAACGAAAAAATTATT
ACCTTCAGAGAAAAAAACAGAAGTATGGAAGTTATAACTCCTAAAAACTTGTTGAATAAT
TTTGGAATAGCTCTAGAATGA


>TTHERM_00387050(protein)
MQNYYKWHKIKQEQNQELSVNIKPISSSKMKQSDISTRKKKAQEYNMDFDEFQQEDSKIN
QNSDNFHFGDSADEYGIDSPKMKREKAVKEEDNTFRLEIKKSPILEKTLFSFLVKFYNQV
QQSKKGQRKKFVQRFIDSTFKTNRCPSYTFTILRLIMPHHDKQRLNYGLNYKNLAKVLSE
VFALSEDKRQQLLNYKRPLKDNQQVVGDFGEVVQNVLQAFTQKATLTINDVDRCLDELAQ
PQNRDLASKEKVLRNCLKNATSEEIKWISRLILKDLNLGINHEIILALFHPDAVVLFNST
SSLWEVCKEFVDPNHKLSNVLRLFHPIKPMLAGRKTLKSIEAILKGKNYLVETKFDGERI
QCHVSPESLMFFTRNSNNYTNIYERMIEHVRRSLKDAVHSCILDGEMVVVNKITGQRVQF
GLNKTVAMEREDDELCICYKIFDILYLKTKDNKEYALTEYTLQYRKKILENLIDNQQDRV
EVIFGREYSDINDILTEFNEAIHRNDEGIVIKQLDTLYYPDDRSDKWIKMKGDYYEGIID
TLDLIVIGGYFGEKSYKINGIGDWTDHITHYLVAVAKKIDLQNPSNSILVPFAKVGAGFT
ARDYADIKARMRDQWVRTNHSNKTPSFIIQNWKPGEKDKPDAYILSPQNSLILEIRATEI
IQSSQYPTNYTLRFPRFEKFRRDKDWFDCMKFNEIIEMTQNLKKKEQKESDKEDNASDEE
QDENGGKLKKKRKGQNGEEIEVNRQGRKPNWKTNKVMAQYLDIDVSDVKVESNIFNNFVF
NIINLPHEVSLSEEKILLEKAQIEKGIVANGGKKVQNDSNLVTHYIASHYDFKVQVIGDH
YKVNVLSLQWVKDCIKKKTLLDYSPRYIIYGQDQLLERNKLLYDQYGDSYYKDVDEDELL
DILKSMKIDQIEEEFQENEEFEEAVKDIISMKNQLFKECFPQGQTYCFYNANDKLNSDID
LRYLVDLIQFSGNQVVFDLQDEIDYIVALDYSEAENEKIITFREKNRSMEVITPKNLLNN
FGIALE


>TTHERM_00387050(gene)
ATGCAAAACTATTATAAATGGCATAAGATAAAATAAGAATAAAATCAAGAATTGTCTGTT
AATATAAAGCCAATTTCTTCATCAAAGATGAAACAAAGTGATATTTCTACTAGGAAGAAA
AAAGCTTAAGAGTATAATATGGATTTTGATGAATTTTAGCAAGAGGATTCTAAAATTAAC
TAAAATTCTGATAATTTTCACTTTGGTGATTCAGCAGATGAATATGGTATTGATTCACCA
AAAATGAAAAGAGAAAAAGCAGTTAAAGAAGAAGATAATACCTTTCGCTTAGAAATTAAA
AAATCTCCTATCCTAGAGAAAACACTCTTTTCATTTTTAGTCAAATTTTATAATTAAGTC
TAGCAATCTAAAAAAGGGCAAAGAAAAAAATTTGTATAAAGATTCATTGACTCTACATTT
AAAACAAATAGATGTCCATCTTACACATTTACTATCCTTAGGTTAATAATGCCTCATCAT
GATAAATAACGTCTTAATTATGGCTTAAACTATAAAAATTTAGCTAAAGTTTTAAGCGAA
GTGTTTGCCTTATCAGAAGATAAACGTCAATAGCTTTTGAATTATAAAAGACCTTTAAAA
GACAACTAGCAAGTAGTTGGTGATTTTGGTGAAGTTGTATAAAATGTTTTGTAAGCATTT
ACTTAGAAAGCCACACTAACAATCAACGATGTGGATAGATGTCTTGATGAGCTTGCATAA
CCTCAAAATAGAGATCTAGCATCCAAAGAAAAAGTTTTAAGAAACTGCTTGAAGAATGCA
ACATCAGAAGAAATAAAATGGATTTCACGGTAATTTAATTTATTTTAATTAATATTAAAT
AAAAATCTATAAAAGTTTGATCTTAAAGGACCTTAATCTTGGTATTAATCACGAAATAAT
ACTTGCACTTTTTCATCCTGATGCAGTAGTATTATTTAATTCTACTTCTAGTCTTTGGGA
GGTTTGCAAGGAATTTGTAGATCCAAATCATAAATTATCTAATGTCCTTAGGCTATTTCA
TCCTATAAAACCTATGCTTGCAGGACGTAAGACTCTCAAAAGTATTGAAGCTATTCTTAA
AGGTAAGTAAAATATTAATTAATTTGAAACATTTAACATCCTTTTTACTTTTTTTTATAC
AGGTAAAAACTATTTAGTTGAAACAAAATTTGATGGGGAGAGAATTTAGTGTCATGTATC
TCCTGAATCTTTAATGTAAAAAAATTTTTTTTATATTTTTTTTGGTTTAACTTAATAATA
AAAATAGGTTTTTCACTAGAAACTCAAACAATTATACAAATATTTATGAAAGAATGATAG
AGCATGTTAGAAGAAGTTTAAAAGATGCTGTTCATAGTTGTATTTTAGATGGAGAAATGG
TTGTAGTAAATAAAATAACAGGATAAAGAGTTTAATTTGGTCTTAATAAAACTGTTGCAA
TGGAAAGAGAGGATGATGAATTATGTATATGTTATAAAATTTTTGACATTTTATATTTGA
AGACTAAAGATAATAAAGAATATGCACTGACAGAATACACATTGCAATATAGAAAAAAAA
TTTTAGAAAATTTAATTGACAATCAATAAGACAGAGTTGAAGTTATTTTTGGTAGAGAAT
ACTCAGATATAAATGACATACTGACTGAATTTAATGAGGCAATACATAGAAACGATGAAG
GTATAGTCATAAAGCAGCTCGATACTCTGTATTACCCAGATGATAGATCTGATAAGTGGA
TTAAAATGAAAGGTGACTACTATGAAGGAATAATAGATACCTTAGATTTGATAGTTATTG
GAGGATATTTTGGTGAAAAGTCTTATAAAATTAATGGCATAGGAGATTGGACAGATCATA
TCACACATTATCTTGTTGCTGTAGCGAAAAAGATTGATCTACAAAACCCCTCTAACTCTA
TACTTGTGCCTTTTGCTAAAGTGGGAGCAGGTTTTACAGCTAGAGACTATGCTGATATAA
AAGCTAGAATGAGAGATCAATGGGTAAGAACTAATCATTCAAATAAAACGCCTTCTTTCA
TCATATAAAACTGGAAACCTGGAGAAAAAGTAAGTTATTTAGAAAAATAATGACTTTTTA
AAAAAATAAAATTTAAGGATAAGCCAGATGCATATATTTTATCTCCTCAAAACTCTCTTA
TTTTAGAGATTAGGGCAACTGAAATTATATAATCTTCTTAATATCCGACCAACTACACCT
TAAGGTATTTATCTATTTTTAAAATACAATTTAAATGAAGTTTTGTAATATCCTAAATTA
AATTTTAGATTTCCGAGATTTGAAAAATTTAGAAGAGATAAAGATTGGTTTGATTGCATG
AAATTTAATGAAATTATAGAAATGACTTAAAATTTAAAGAAAAAAGAATAAAAAGAGAGT
GACAAAGAAGATAATGCAAGCGATGAAGAGTAGGACGAAAATGGAGGAAAATTAAAGAAA
AAAAGAAAAGGGTAAAATGGAGAAGAGATAGAAGTAAATAGACAAGGTAGAAAGCCAAAC
TGGAAGACCAATAAAGTTATGGCTCAATATCTTGATATTGATGTTTCTGATGTCAAAGTA
GAATCAAATATATTTAATAACTTTGTATTTAATATAATTAATTTACCTCATGAAGTATCC
TTGAGTGAGGAAAAGATATTGTTAGAGAAAGCCTAGATTGAAAAAGGTATAGTTGCTAAT
GGTGGTAAAAAAGTATAAAATGATAGCAATCTTGTAACTCATTACATAGCTTCACATTAT
GATTTTAAAGTTTAAGTAATTGGTGATCACTATAAAGTAAATGTTCTATCCTTATAATGG
GTAAAAGACTGTATCAAAAAAAAAACTTTATTAGATTACTCTCCCCGCTACATTATATAT
GGTTAAGATTAATTGCTTGAGAGAAATAAATTGCTTTATGATTAATATGGAGATTCTTAT
TACAAAGATGTTGATGAAGATGAGTTATTGGATATTTTAAAATCTATGAAAATTGATTAA
ATAGAAGAAGAATTCTAGGAGAATGAAGAGTTTGAAGAGGCTGTTAAAGATATTATTTCC
ATGAAAAACCAACTTTTCAAAGAATGTTTTCCGTAAGGATAAACTTATTGCTTTTATAAT
GCAAATGATAAATTGAATTCAGATATAGACTTAAGATATTTAGTTGATCTAATTTAATTT
AGTGGAAATTAAGTTGTATTTGACTTATAGGACGAAATTGATTACATAGTGGCTTTAGAT
TATAGTGAAGCTGAAAACGAAAAAATTATTACCTTCAGAGAAAAAAACAGAAGTATGGAA
GTTATAACTCCTAAAAACTTGTTGAATAATTTTGGAATAGCTCTAGAATGA