Identifiers and Description

Gene Model Identifier

TTHERM_00387050

Standard Name

LIG4 (DNA ligase IV)

Aliases

PreTt24799 | 41.m00206

Description

DNA ligase required for nonhomologous end-joining (NHEJ)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02776 ) DNA ligase D
  • ( PF04675 ) DNA ligase N terminus
  • ( PF01779 ) ribosomal L29e protein family
  • ( PF00533 ) BRCA1 C Terminus (BRCT) domain
  • ( PF01068 ) ATP-dependent DNA ligase domain
  • ( TIGR00574 ) DNA ligase I, ATP-dependent (dnl1)
  • ( TIGR02779 ) DNA polymerase LigD, ligase domain
  • ( PF01331 ) mRNA capping enzyme, catalytic domain
  • ( PF04679 ) ATP dependent DNA ligase C

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04427.19.99709313703352e-262DNA ligase IV (1028 aa)
OxytrichaContig17485.0.g1016.00104808673103e-152ATP dependent DNA ligase domai
n
ParameciumDBGSPATP000177510011.00034910302318e-151Paramecium tetraurelia GSPATP0
0017751001 protein
IPI(HUMAN)IPI:IPI00217669.11.99902261670571e-90 PROT:P49917|ENSEMBL:ENSP00000
310449;ENSP00000349393|REFS EQ
:NP_002303;NP_996820|H- INV:HI
T000051922;HIT000057480|VEGA:O
TTHUMP00000018690 Tax_Id=9606
DNA ligase 4
DictyBaseDDB01845486.00130908048896e-82lig4 BRCT domain-containing pr
otein DNA ligase IV
DictyBaseDDB02322556.00130908048896e-82lig4 BRCT domain-containing pr
otein DNA ligase IV
TAIRAT5G571603.99903131499923e-77DNA ligase IV
FlyBaseFBgn00305064.00052193233065e-52
SGDYOR005C5.00068001281662e-42DNL4 SGDID:S000005531, Chr XV
from 337344-334510, reverse co
mplement, Verified ORF, "DNA l
igase required for nonhomologo
us end-joining (NHEJ), forms s
table heterodimer with require
d cofactor Lif1p, catalyzes DN
A ligation as part of a comple
x with Lif1p and Nej1p; involv
ed in meiosis, not essential f
or vegetative growth"
WormBaseC29A12.3a3.99801309251602e-27WBGene00002985 lig-1 DNA ligas
e I
ToxoDB25.m018201.00045724336694e-23Toxoplasma gondii DNA ligase 1
precursor, putative
CryptoDBEAK889722.99975816542199e-18Cryptosporidium parvum (Iowa)
protein EAK88972
PlasmoDBMAL13P1.223.00100304433762e-17Plasmodium falciparum 22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00387050(coding)
ATGCAAAACTATTATAAATGGCATAAGATAAAATAAGAATAAAATCAAGAATTGTCTGTT
AATATAAAGCCAATTTCTTCATCAAAGATGAAACAAAGTGATATTTCTACTAGGAAGAAA
AAAGCTTAAGAGTATAATATGGATTTTGATGAATTTTAGCAAGAGGATTCTAAAATTAAC
TAAAATTCTGATAATTTTCACTTTGGTGATTCAGCAGATGAATATGGTATTGATTCACCA
AAAATGAAAAGAGAAAAAGCAGTTAAAGAAGAAGATAATACCTTTCGCTTAGAAATTAAA
AAATCTCCTATCCTAGAGAAAACACTCTTTTCATTTTTAGTCAAATTTTATAATTAAGTC
TAGCAATCTAAAAAAGGGCAAAGAAAAAAATTTGTATAAAGATTCATTGACTCTACATTT
AAAACAAATAGATGTCCATCTTACACATTTACTATCCTTAGGTTAATAATGCCTCATCAT
GATAAATAACGTCTTAATTATGGCTTAAACTATAAAAATTTAGCTAAAGTTTTAAGCGAA
GTGTTTGCCTTATCAGAAGATAAACGTCAATAGCTTTTGAATTATAAAAGACCTTTAAAA
GACAACTAGCAAGTAGTTGGTGATTTTGGTGAAGTTGTATAAAATGTTTTGTAAGCATTT
ACTTAGAAAGCCACACTAACAATCAACGATGTGGATAGATGTCTTGATGAGCTTGCATAA
CCTCAAAATAGAGATCTAGCATCCAAAGAAAAAGTTTTAAGAAACTGCTTGAAGAATGCA
ACATCAGAAGAAATAAAATGGATTTCACGTTTGATCTTAAAGGACCTTAATCTTGGTATT
AATCACGAAATAATACTTGCACTTTTTCATCCTGATGCAGTAGTATTATTTAATTCTACT
TCTAGTCTTTGGGAGGTTTGCAAGGAATTTGTAGATCCAAATCATAAATTATCTAATGTC
CTTAGGCTATTTCATCCTATAAAACCTATGCTTGCAGGACGTAAGACTCTCAAAAGTATT
GAAGCTATTCTTAAAGGTAAAAACTATTTAGTTGAAACAAAATTTGATGGGGAGAGAATT
TAGTGTCATGTATCTCCTGAATCTTTAATGTTTTTCACTAGAAACTCAAACAATTATACA
AATATTTATGAAAGAATGATAGAGCATGTTAGAAGAAGTTTAAAAGATGCTGTTCATAGT
TGTATTTTAGATGGAGAAATGGTTGTAGTAAATAAAATAACAGGATAAAGAGTTTAATTT
GGTCTTAATAAAACTGTTGCAATGGAAAGAGAGGATGATGAATTATGTATATGTTATAAA
ATTTTTGACATTTTATATTTGAAGACTAAAGATAATAAAGAATATGCACTGACAGAATAC
ACATTGCAATATAGAAAAAAAATTTTAGAAAATTTAATTGACAATCAATAAGACAGAGTT
GAAGTTATTTTTGGTAGAGAATACTCAGATATAAATGACATACTGACTGAATTTAATGAG
GCAATACATAGAAACGATGAAGGTATAGTCATAAAGCAGCTCGATACTCTGTATTACCCA
GATGATAGATCTGATAAGTGGATTAAAATGAAAGGTGACTACTATGAAGGAATAATAGAT
ACCTTAGATTTGATAGTTATTGGAGGATATTTTGGTGAAAAGTCTTATAAAATTAATGGC
ATAGGAGATTGGACAGATCATATCACACATTATCTTGTTGCTGTAGCGAAAAAGATTGAT
CTACAAAACCCCTCTAACTCTATACTTGTGCCTTTTGCTAAAGTGGGAGCAGGTTTTACA
GCTAGAGACTATGCTGATATAAAAGCTAGAATGAGAGATCAATGGGTAAGAACTAATCAT
TCAAATAAAACGCCTTCTTTCATCATATAAAACTGGAAACCTGGAGAAAAAGATAAGCCA
GATGCATATATTTTATCTCCTCAAAACTCTCTTATTTTAGAGATTAGGGCAACTGAAATT
ATATAATCTTCTTAATATCCGACCAACTACACCTTAAGATTTCCGAGATTTGAAAAATTT
AGAAGAGATAAAGATTGGTTTGATTGCATGAAATTTAATGAAATTATAGAAATGACTTAA
AATTTAAAGAAAAAAGAATAAAAAGAGAGTGACAAAGAAGATAATGCAAGCGATGAAGAG
TAGGACGAAAATGGAGGAAAATTAAAGAAAAAAAGAAAAGGGTAAAATGGAGAAGAGATA
GAAGTAAATAGACAAGGTAGAAAGCCAAACTGGAAGACCAATAAAGTTATGGCTCAATAT
CTTGATATTGATGTTTCTGATGTCAAAGTAGAATCAAATATATTTAATAACTTTGTATTT
AATATAATTAATTTACCTCATGAAGTATCCTTGAGTGAGGAAAAGATATTGTTAGAGAAA
GCCTAGATTGAAAAAGGTATAGTTGCTAATGGTGGTAAAAAAGTATAAAATGATAGCAAT
CTTGTAACTCATTACATAGCTTCACATTATGATTTTAAAGTTTAAGTAATTGGTGATCAC
TATAAAGTAAATGTTCTATCCTTATAATGGGTAAAAGACTGTATCAAAAAAAAAACTTTA
TTAGATTACTCTCCCCGCTACATTATATATGGTTAAGATTAATTGCTTGAGAGAAATAAA
TTGCTTTATGATTAATATGGAGATTCTTATTACAAAGATGTTGATGAAGATGAGTTATTG
GATATTTTAAAATCTATGAAAATTGATTAAATAGAAGAAGAATTCTAGGAGAATGAAGAG
TTTGAAGAGGCTGTTAAAGATATTATTTCCATGAAAAACCAACTTTTCAAAGAATGTTTT
CCGTAAGGATAAACTTATTGCTTTTATAATGCAAATGATAAATTGAATTCAGATATAGAC
TTAAGATATTTAGTTGATCTAATTTAATTTAGTGGAAATTAAGTTGTATTTGACTTATAG
GACGAAATTGATTACATAGTGGCTTTAGATTATAGTGAAGCTGAAAACGAAAAAATTATT
ACCTTCAGAGAAAAAAACAGAAGTATGGAAGTTATAACTCCTAAAAACTTGTTGAATAAT
TTTGGAATAGCTCTAGAATGA


>TTHERM_00387050(protein)
MQNYYKWHKIKQEQNQELSVNIKPISSSKMKQSDISTRKKKAQEYNMDFDEFQQEDSKIN
QNSDNFHFGDSADEYGIDSPKMKREKAVKEEDNTFRLEIKKSPILEKTLFSFLVKFYNQV
QQSKKGQRKKFVQRFIDSTFKTNRCPSYTFTILRLIMPHHDKQRLNYGLNYKNLAKVLSE
VFALSEDKRQQLLNYKRPLKDNQQVVGDFGEVVQNVLQAFTQKATLTINDVDRCLDELAQ
PQNRDLASKEKVLRNCLKNATSEEIKWISRLILKDLNLGINHEIILALFHPDAVVLFNST
SSLWEVCKEFVDPNHKLSNVLRLFHPIKPMLAGRKTLKSIEAILKGKNYLVETKFDGERI
QCHVSPESLMFFTRNSNNYTNIYERMIEHVRRSLKDAVHSCILDGEMVVVNKITGQRVQF
GLNKTVAMEREDDELCICYKIFDILYLKTKDNKEYALTEYTLQYRKKILENLIDNQQDRV
EVIFGREYSDINDILTEFNEAIHRNDEGIVIKQLDTLYYPDDRSDKWIKMKGDYYEGIID
TLDLIVIGGYFGEKSYKINGIGDWTDHITHYLVAVAKKIDLQNPSNSILVPFAKVGAGFT
ARDYADIKARMRDQWVRTNHSNKTPSFIIQNWKPGEKDKPDAYILSPQNSLILEIRATEI
IQSSQYPTNYTLRFPRFEKFRRDKDWFDCMKFNEIIEMTQNLKKKEQKESDKEDNASDEE
QDENGGKLKKKRKGQNGEEIEVNRQGRKPNWKTNKVMAQYLDIDVSDVKVESNIFNNFVF
NIINLPHEVSLSEEKILLEKAQIEKGIVANGGKKVQNDSNLVTHYIASHYDFKVQVIGDH
YKVNVLSLQWVKDCIKKKTLLDYSPRYIIYGQDQLLERNKLLYDQYGDSYYKDVDEDELL
DILKSMKIDQIEEEFQENEEFEEAVKDIISMKNQLFKECFPQGQTYCFYNANDKLNSDID
LRYLVDLIQFSGNQVVFDLQDEIDYIVALDYSEAENEKIITFREKNRSMEVITPKNLLNN
FGIALE


>TTHERM_00387050(gene)
ATGCAAAACTATTATAAATGGCATAAGATAAAATAAGAATAAAATCAAGAATTGTCTGTT
AATATAAAGCCAATTTCTTCATCAAAGATGAAACAAAGTGATATTTCTACTAGGAAGAAA
AAAGCTTAAGAGTATAATATGGATTTTGATGAATTTTAGCAAGAGGATTCTAAAATTAAC
TAAAATTCTGATAATTTTCACTTTGGTGATTCAGCAGATGAATATGGTATTGATTCACCA
AAAATGAAAAGAGAAAAAGCAGTTAAAGAAGAAGATAATACCTTTCGCTTAGAAATTAAA
AAATCTCCTATCCTAGAGAAAACACTCTTTTCATTTTTAGTCAAATTTTATAATTAAGTC
TAGCAATCTAAAAAAGGGCAAAGAAAAAAATTTGTATAAAGATTCATTGACTCTACATTT
AAAACAAATAGATGTCCATCTTACACATTTACTATCCTTAGGTTAATAATGCCTCATCAT
GATAAATAACGTCTTAATTATGGCTTAAACTATAAAAATTTAGCTAAAGTTTTAAGCGAA
GTGTTTGCCTTATCAGAAGATAAACGTCAATAGCTTTTGAATTATAAAAGACCTTTAAAA
GACAACTAGCAAGTAGTTGGTGATTTTGGTGAAGTTGTATAAAATGTTTTGTAAGCATTT
ACTTAGAAAGCCACACTAACAATCAACGATGTGGATAGATGTCTTGATGAGCTTGCATAA
CCTCAAAATAGAGATCTAGCATCCAAAGAAAAAGTTTTAAGAAACTGCTTGAAGAATGCA
ACATCAGAAGAAATAAAATGGATTTCACGGTAATTTAATTTATTTTAATTAATATTAAAT
AAAAATCTATAAAAGTTTGATCTTAAAGGACCTTAATCTTGGTATTAATCACGAAATAAT
ACTTGCACTTTTTCATCCTGATGCAGTAGTATTATTTAATTCTACTTCTAGTCTTTGGGA
GGTTTGCAAGGAATTTGTAGATCCAAATCATAAATTATCTAATGTCCTTAGGCTATTTCA
TCCTATAAAACCTATGCTTGCAGGACGTAAGACTCTCAAAAGTATTGAAGCTATTCTTAA
AGGTAAGTAAAATATTAATTAATTTGAAACATTTAACATCCTTTTTACTTTTTTTTATAC
AGGTAAAAACTATTTAGTTGAAACAAAATTTGATGGGGAGAGAATTTAGTGTCATGTATC
TCCTGAATCTTTAATGTAAAAAAATTTTTTTTATATTTTTTTTGGTTTAACTTAATAATA
AAAATAGGTTTTTCACTAGAAACTCAAACAATTATACAAATATTTATGAAAGAATGATAG
AGCATGTTAGAAGAAGTTTAAAAGATGCTGTTCATAGTTGTATTTTAGATGGAGAAATGG
TTGTAGTAAATAAAATAACAGGATAAAGAGTTTAATTTGGTCTTAATAAAACTGTTGCAA
TGGAAAGAGAGGATGATGAATTATGTATATGTTATAAAATTTTTGACATTTTATATTTGA
AGACTAAAGATAATAAAGAATATGCACTGACAGAATACACATTGCAATATAGAAAAAAAA
TTTTAGAAAATTTAATTGACAATCAATAAGACAGAGTTGAAGTTATTTTTGGTAGAGAAT
ACTCAGATATAAATGACATACTGACTGAATTTAATGAGGCAATACATAGAAACGATGAAG
GTATAGTCATAAAGCAGCTCGATACTCTGTATTACCCAGATGATAGATCTGATAAGTGGA
TTAAAATGAAAGGTGACTACTATGAAGGAATAATAGATACCTTAGATTTGATAGTTATTG
GAGGATATTTTGGTGAAAAGTCTTATAAAATTAATGGCATAGGAGATTGGACAGATCATA
TCACACATTATCTTGTTGCTGTAGCGAAAAAGATTGATCTACAAAACCCCTCTAACTCTA
TACTTGTGCCTTTTGCTAAAGTGGGAGCAGGTTTTACAGCTAGAGACTATGCTGATATAA
AAGCTAGAATGAGAGATCAATGGGTAAGAACTAATCATTCAAATAAAACGCCTTCTTTCA
TCATATAAAACTGGAAACCTGGAGAAAAAGTAAGTTATTTAGAAAAATAATGACTTTTTA
AAAAAATAAAATTTAAGGATAAGCCAGATGCATATATTTTATCTCCTCAAAACTCTCTTA
TTTTAGAGATTAGGGCAACTGAAATTATATAATCTTCTTAATATCCGACCAACTACACCT
TAAGGTATTTATCTATTTTTAAAATACAATTTAAATGAAGTTTTGTAATATCCTAAATTA
AATTTTAGATTTCCGAGATTTGAAAAATTTAGAAGAGATAAAGATTGGTTTGATTGCATG
AAATTTAATGAAATTATAGAAATGACTTAAAATTTAAAGAAAAAAGAATAAAAAGAGAGT
GACAAAGAAGATAATGCAAGCGATGAAGAGTAGGACGAAAATGGAGGAAAATTAAAGAAA
AAAAGAAAAGGGTAAAATGGAGAAGAGATAGAAGTAAATAGACAAGGTAGAAAGCCAAAC
TGGAAGACCAATAAAGTTATGGCTCAATATCTTGATATTGATGTTTCTGATGTCAAAGTA
GAATCAAATATATTTAATAACTTTGTATTTAATATAATTAATTTACCTCATGAAGTATCC
TTGAGTGAGGAAAAGATATTGTTAGAGAAAGCCTAGATTGAAAAAGGTATAGTTGCTAAT
GGTGGTAAAAAAGTATAAAATGATAGCAATCTTGTAACTCATTACATAGCTTCACATTAT
GATTTTAAAGTTTAAGTAATTGGTGATCACTATAAAGTAAATGTTCTATCCTTATAATGG
GTAAAAGACTGTATCAAAAAAAAAACTTTATTAGATTACTCTCCCCGCTACATTATATAT
GGTTAAGATTAATTGCTTGAGAGAAATAAATTGCTTTATGATTAATATGGAGATTCTTAT
TACAAAGATGTTGATGAAGATGAGTTATTGGATATTTTAAAATCTATGAAAATTGATTAA
ATAGAAGAAGAATTCTAGGAGAATGAAGAGTTTGAAGAGGCTGTTAAAGATATTATTTCC
ATGAAAAACCAACTTTTCAAAGAATGTTTTCCGTAAGGATAAACTTATTGCTTTTATAAT
GCAAATGATAAATTGAATTCAGATATAGACTTAAGATATTTAGTTGATCTAATTTAATTT
AGTGGAAATTAAGTTGTATTTGACTTATAGGACGAAATTGATTACATAGTGGCTTTAGAT
TATAGTGAAGCTGAAAACGAAAAAATTATTACCTTCAGAGAAAAAAACAGAAGTATGGAA
GTTATAACTCCTAAAAACTTGTTGAATAATTTTGGAATAGCTCTAGAATGA