Identifiers and Description

Gene Model Identifier

TTHERM_00384880

Standard Name

None

Aliases

PreTt24780 | 41.m00187

Description

Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF00069 ) protein kinase domain
  • ( PF05391 ) Lsm interaction motif
  • ( PF01290 ) Thymosin beta-4 family
  • ( PF07714 ) protein tyrosine kinase
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF02841 ) Guanylate-binding protein, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00384880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04407.19.997093137033517e-262hypothetical protein (680 aa)
OxytrichaContig3837.0.g132.0001081030036656e-67Protein kinase domain
DictyBaseDDB_G02794053.999543040313994e-55DDB_G0279405 on chromosome: 3
position 1975813 to 1977989
WormBaseWBGene000005183.0006824396935516e-51locus:ckk-1 status:Confirmed
UniProt:G5EDZ4 protein_id
:CCD63131.1
SGDYDR477W6.001376218974307e-41SNF1 AMP-activated serine/thre
onine protein kinase found in
a complex containing Snf4p and
members of the Sip1p/Sip2p/Ga
l83p family; required for tran
scription of glucose-repressed
genes, thermotolerance, sporu
lation, and peroxisome biogene
sis
Stentor CoeruleusSteCoe_19514.359610000063081e-28

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00384880(coding)
ATGGGATGTGGAAGTACAAGATTTTAAGTTTAAGGAAATTAACCTCTTTCATAAAAAAAC
AAAAAGCTCAATAAATTTTATGAAACCAAAGAAATCGGAATATAGACTTCCTACAATAAT
TTGTATGATAAATTAGAAAGCGAAAAACCTCCAACTCCTAAATAAGTTAGGACAGAGGGA
GTCAATATCCATGTAAAACCAATTAATAACCCTGTTATAAGGAGAAATACTATGAGGCAT
GAATCTACTAGGGTTTTGAAGAAAAAGAGTAGCTTTTTCCATTAAAAAGATAATGAATAG
AACAAATCGAAAGACTCAGATATATTTAGCTTCGATAACAATAATGGAGGGAAAACAGGA
TAGCTTGAAAAATCAGAGTAGCTACAGGGTAATAAATAGAATAGTAATAATTCATAGGAA
TTTGACTCTCCGTTCGGATAGCAAAGGAATAACGACAGTGAAAATAAAATTGATATTTAG
AATTTAAATAGTAATAACAATAGCATTTAAAATAGTGTAGGAAGGGATCATTTAAACTCA
CCATCCTTAGCTAATTAGACAGCTAATTTTTTTAAAAATGGAGAAAATGATAATTTCAGT
AGTAGGGAGTATAATAATTCATCACCTTAAATATTTTCAAATAATATAATACCTGAAACA
GCAAATAAAAATATAATTGAGCGTCAAAATAATCGTACGCCTACCTTGAGTAAGCCAAGC
TCGTTGATAAACCCTACATTTAGTAATGACTACATTTTGGTAGGAGGAATAGCAACTGAG
TAGAATATTAGTGGCTTAGGTAATGGTATAATAGTGAATCATAGCAATTAATATGGTAAG
TAATTAAGCTAAATCAGTGAAGAAAAAGAAATGAGTTTACTTACTAACCATATAAGAAGG
ACTAATTAAAAAAAAAGTTCGATAAAAGTAGATAATGATTCAAACAATAGCTAATCTGAT
AATAATTTAGTATAAGGCAATGCCACGAGTAGAGGCTCTGCAAATATTACTACGGCAGAT
TAGACTAGCCCTTAGAATTGTTAAGGTTTGAATGGGACAATCATTAATGCTATTGGAAAT
TACAACAACAATGCTTTTAATAATTAAAATAATATCTTGCAAAAAGAAATTACTTGTAAT
CAAAATAATTAAATCAATGCTAATACTAATAAAGCTGCTTGTGCTAAGGAGTAATAAAAT
GATGTAGTTTTTAATGAAAATAATACAATTTAAATCTCGACTTAAATAAATAATAAATCA
AATAATTTGAATAAAGAAGAAAATGATTAAAATGAAGAAAAAATAAATAAAACATAATCT
CAAGATCCTTCTATGCCTTTATAATAATAGAAATCTAATGGATCTTTTAGGATAAAAAAA
AATATGAATACAAAAAGTGTTTCTGTGCATACAAGTCCAAATGAAATAATTGAAAAAAGC
TACTAAAAATAAAATAGCTTACATAAAAATGAAATACTCAACTAAAATACCATAAGATAA
AACAATTTCTATAACAATTAACATGTATCAAGCCACGATTTTGTCCCGATCGAATAGCAG
AATAATCCTGTGATGCAATCTAGAGATGAGCAACATTCAAATATATTCTTTAATAATACA
ACTTCTCCAAAAAAATAAAATACTATAAATAATACACCATAAAGTAATCAAAAGAGTAGT
ATTAATTTAATAGATTATGTAAAGAATCAATAGTTAGCTTAGAGAGAAACATTCAGAAAT
AATTAGTAAAGTATATATAATCATTTCAGACAGTTCAAGCAACCGTTAAAGTAAGACTCA
GATAAACTTAATAATATTAATCTTTAAGACGATTACTAAAATCTATAGTCAGCAGGCTTA
AAATAAACAAGAAAGTTGTCAAGATTAAATCCCAGAATGAGCTAAAATATAACAAAGTTT
GTATCACCTAAAACAAATCTTATCGAATTTGTTTAATAGATGCAATACAAAAGCTAGAGA
AACAGCTCTGTTTCATTGCAGAGTCCTTTTTTATTTCAAAGTTAATTTTAACCCTAAAAC
TATTATGACCAAAACATGGAAATAGATGGACTTTCTCCTATTAGTTCAAACGTAAATCCT
AATTTTAGAGGTGGATACGATTACGATGTAGAAGATGAAGAAGTAGCAAGACAAATGGAA
AATGATAAGTCTAATATGAATATTGCTAGCATGACAAACTTTTAAAACTCCAATAATTCT
AGCAGTTATGAGGAACAAAGAGGTGCTTACTCTCCTTACTCTAAAGAATAATCTTAAACA
ATATCTGTTTTACCTTCTATAATTAATGGGTCAGAATTTTGCGATAACTCTAAAATAGAT
TTTGATAAATATGATATAGAATACATAGATGGATATGATGGTGTGTACAAAGGCTAAAAT
AATTTGCTATCTTCTAAATTACAGCATTCATAAATTTTAAATAGTTAGCTATTCTCATAA
TAGAATGTAGTATTGCCAAGCAGTATTGCAAATAGCTAATCAGTTTATTAAAATTCTAAA
ACTCAACCAAGCAATAAATAATTACCTTCTTAATCCGGGATCCATAGTTAAGTTATAGGT
TCTATGAATTCTCTAAAAGTAAACTCTCCTCAACTAACAGGTCTCATTTATTAAAATATT
CCAAATTTACAAAAAAGATCAGTAAGTGCAGCTCCAAATTAATCTTAAATGTTAATTTCA
AATCAACAATAAAATGGAAACGCAAATCCTCAATTTAAAAAAGTTTTTAGTGAATTTGAC
TCTTCTCCCATATCTTAAAATTAGTTTAGCCATAAATATTCATCAAAAAAAGTATCAAAA
AAAGAATCTATTAGCCCAAAAACAGATGGAAAGTAAATACTAAATTTTACTTAATCTTCA
TCTACTCACAACCAAGCTTAAACTTCTTTAAAAGATTTATAGTAAGGAAAATAACAAATT
TAAAATTAGAACTAAGAAGATTAATAAAATCTAAATAAGAACTAAAATTCTAAATAGATC
AATTCAAATTATAACTTTGGTCAAATCTCTTCTTCTTAAAATATTGCATAATAGGGTCAG
ATATAACAATAACTATCATTATAATAACAATAATTATAATTGTAAAAACAATAACAATAG
TAATAGCAATAATTTTAATAATAATTATAATAGTAGTTTACTTATGAAACTAATTAAAAA
TTGTATAGTTAAAATTCTAATTTATTGAATCAAATGATATAACAGTCTTAATTGAATAAC
TAAAATCCCATTTAGCTAAGAAAGCAGAGCTCTTCATCTCGACGCTCTAACCAAAGTATA
CACTAACCTAATAGAGGTATAGAAAATAAAAATAACTAGACAAGTAATACAAATGAAAGC
AAATCGAGTGTAAATCAAAGTAGTGGCAATGGCTTTTATAACTCCTCTGATAAAAAAGGA
GTACCTTTAATTAAATCATTAGAAAATAAGATAAGAAATAGCATAAATAGCAGTCCTAGT
AAAAATTCATCCAATCACCTTTCACCAACCTATGCTACTGATAAAAAATTTGTCAGAAGT
AGTAATAGAAAAACAACCATGGAGGTCAAAGATATTATTCGAAAGCGCTCTGATTCCAGT
TTAAGTCAGAATTCAAATGATTCTCTTTTAACAAATTAAGAAAATATGCTATAAAAAGAA
AAGCCCTAAGCTACTGCATCATAATTTTAAAAACTGTACAAAGGCAATACAAAAGAAAAT
GCAGAAATTCAACTAAATTCAAATTAAGAATTGCTAACAAATGATCAAGTGGAATTTAAT
AACTAGGGATAAGCTCAGAATAATAAGAAATAAGATTAAGTAAATCCTGCTTAAATCGCA
AATAAACAAAGTAATAATACTTCAGTAAGCAGCAATCAACAAAACTTAAATAAATTAAAT
AGTAATGAAGTTACTAATAAAAATAGCTCTAAAAATACTACTAACTAAACTCCAAAAGAA
TTCACAACCTCTAACAGTAATAGCTCTTCTGCTTAACAGACACCCTAAAATAAACCAATT
AATCTCATTTAACTTGCTAAATAAAATGTCTAAATAAGCTAGTAAGGTGATTAAATCAAG
CAACAGTAGCTATATTTGTAGCAATACCAATAATAGCTATAATAAAAAATAATAAATAAC
AAAAAAACAAACTTAATTGTTTTATAAAATCCAACTTTACTAAATTCTCTGTATAATATA
TCTGAAGAACCTAATGAACAGTATACTGATATGCAAAGTAAATCAAATTTCGATTTTGCA
TCTTCTATAAATGGTCGCTCTCAATTGCTTGATTAAACATAAAATAATAATTCTAATTAT
AAACCAACTTAAAATTTACTTTTAAGCAATTTCTCACTTTAGACCTAAAAAGATTTAAAT
AAGAAAGCTAGTATAGAATAATTTCCACATAATTTAAAGAATTAGTAAAACACAATTACT
TAGCCTTCAGTTAGTATTTTACTAGAAAATAACTCAACTAATAATGCAATTTAAAGCTAA
AGTATTGTTAACCAAAACCAGACAGTGAAAAATATATCAAGTTATGGAAAGGAGATTTTT
TCTGATAAATAGAAAGTAACTTAGAGTACTCAACAAATTACAAATCATAATGGATAACAA
AAAGACTAAAAGAATTAAAATTTATTAGATCTCTTAACAAATAACATAAGTGAGTAAAAA
GAGTAGAGTTAAACAACAAAAGATTTATAAAAAACAAACTAACTAACTTAACAAAAAGCT
TAAATAAATTAGCATTAAACAACTAATCATTAAACACAATAAAAATCTACAGTCACAGAC
AAAATTTAAATTATATCAGAACCAATATAGACAAAAAATGATATAAAAACTTAACCACAA
ATAGCTTCAAAAGAAAAAGTTGAGAGCTAGTCAATTCTTATTTCAAATATTCTAAAAAGT
TAGGAGGAAATAAAAAAAGAAACTGAATCAGCCAGTACAGATATGACAACTAAAAAGTAA
GAAGAGTAGGCTTCTAAAACTAGAATTTAAGAAATTATCTAAAGAGAGAAAAAGAGAGAG
AATTCACAGAAGAAAATTTAATAAATCACACAACCAACTTAGTCAAAATCAAAAATGAAT
TTCTCTTAAACTCCTTCAATGCTTCCCTAAATGTCAACTAAATTGAGTAATAATAATTTA
TCTGTAAACTCAACAGTTCTTAACAGTTCAAATGTTTTGCCAAGTCAAACATCGTAATCA
AATAAAAAAGATAAGTATCAAAAACTTTCGAAAGCAAATACAGCAAACATTTCTAAAAAT
TTAAGTTATAGCATGCTGTAAGAGTAGCATAGTGTATTGGAGACAAGCAAATTAGATAAA
TCGGTAAATGCTGATGGATAAAAATAAATAAATAACTACATTATTCTCAAAAATATTGGA
CACGGAGCATTTGGAAAAGTCAAATAAGTATTTGACACTAATACTAAAAAACACTTCGCA
GTCAAAATCATCAATAGAGACAAGCTAATGAAGAAAAAGTTAGATAGAAACAAGAGTGCA
TTTAGCTTGATTGAAAAAGAAATAGCTATCTGTAAAAAAATGGCACATCCTAATATAGTT
AAGTTGTATGAATATATTGATGATCAAGATGAAGCCAAGATATATATGATTATGGACTTA
TTGAAAAAAGGTAGTATAAATTCTAAATCTTATTGGAAAACAGAAAAAGGAAAAGAATAT
AAAGAAACGGAAAAATATAATATGTCAGAGTAAAAGCTTAAAAAATACTTTAGAGATTTT
TTACTTGGACTTGATTATTTGCATAACTTTGTGAATGTTGTTCATAGAGATATCAAGCCA
GATAATTTATTGATTGGAGACGAGGATTAGCTAAAAATTGCTGATTTTGGAGTATCCTAA
ATGTTTGAAGGAGAGAAAGACGAATTAAACAATGATAATGGAACAAAGTGCTATTTAGCT
CCAGAGGCATTTACCTCTAACGGATTTAATGGAAGACCTTTAGATATTTGGGCTGCTGGA
GTATCATTATATGAAATTTTTACAGGAAGCAGACCATTTAATGGAAGGACGTTGGAAGTT
CTTAAAAAAAGTATTTTAGAAACTGAACCTAACTATCCAAGTAACATGTCACCTGAGTTT
GTAAGTATGCTTTAAAAATGTCTAAACAAAGATCCAAAGAAGAGAGCTGATGTTTAAGCC
CTAATAGTAGATGATTGGGTTACTGATAAGGGATAGAATCCATTAGAATTTCCTATTTAC
GAAGGAGATTTCCATGATATTAAAGACGACGAATTAAAGAATGCCATTACCAAATCTTTC
TTAAACAAAAGGGTAAACATTCAAGCCAAGTTAAAAGAGAAAATTGTAAAAACTAGAATA
AATATAGAAAAGAAGAAAAGCTTTTAAATAGAAGAAGATGTTAATAATAATACTCTTAAT
GTAAATAAGCTATGA


>TTHERM_00384880(protein)
MGCGSTRFQVQGNQPLSQKNKKLNKFYETKEIGIQTSYNNLYDKLESEKPPTPKQVRTEG
VNIHVKPINNPVIRRNTMRHESTRVLKKKSSFFHQKDNEQNKSKDSDIFSFDNNNGGKTG
QLEKSEQLQGNKQNSNNSQEFDSPFGQQRNNDSENKIDIQNLNSNNNSIQNSVGRDHLNS
PSLANQTANFFKNGENDNFSSREYNNSSPQIFSNNIIPETANKNIIERQNNRTPTLSKPS
SLINPTFSNDYILVGGIATEQNISGLGNGIIVNHSNQYGKQLSQISEEKEMSLLTNHIRR
TNQKKSSIKVDNDSNNSQSDNNLVQGNATSRGSANITTADQTSPQNCQGLNGTIINAIGN
YNNNAFNNQNNILQKEITCNQNNQINANTNKAACAKEQQNDVVFNENNTIQISTQINNKS
NNLNKEENDQNEEKINKTQSQDPSMPLQQQKSNGSFRIKKNMNTKSVSVHTSPNEIIEKS
YQKQNSLHKNEILNQNTIRQNNFYNNQHVSSHDFVPIEQQNNPVMQSRDEQHSNIFFNNT
TSPKKQNTINNTPQSNQKSSINLIDYVKNQQLAQRETFRNNQQSIYNHFRQFKQPLKQDS
DKLNNINLQDDYQNLQSAGLKQTRKLSRLNPRMSQNITKFVSPKTNLIEFVQQMQYKSQR
NSSVSLQSPFLFQSQFQPQNYYDQNMEIDGLSPISSNVNPNFRGGYDYDVEDEEVARQME
NDKSNMNIASMTNFQNSNNSSSYEEQRGAYSPYSKEQSQTISVLPSIINGSEFCDNSKID
FDKYDIEYIDGYDGVYKGQNNLLSSKLQHSQILNSQLFSQQNVVLPSSIANSQSVYQNSK
TQPSNKQLPSQSGIHSQVIGSMNSLKVNSPQLTGLIYQNIPNLQKRSVSAAPNQSQMLIS
NQQQNGNANPQFKKVFSEFDSSPISQNQFSHKYSSKKVSKKESISPKTDGKQILNFTQSS
STHNQAQTSLKDLQQGKQQIQNQNQEDQQNLNKNQNSKQINSNYNFGQISSSQNIAQQGQ
IQQQLSLQQQQLQLQKQQQQQQQQFQQQLQQQFTYETNQKLYSQNSNLLNQMIQQSQLNN
QNPIQLRKQSSSSRRSNQSIHQPNRGIENKNNQTSNTNESKSSVNQSSGNGFYNSSDKKG
VPLIKSLENKIRNSINSSPSKNSSNHLSPTYATDKKFVRSSNRKTTMEVKDIIRKRSDSS
LSQNSNDSLLTNQENMLQKEKPQATASQFQKLYKGNTKENAEIQLNSNQELLTNDQVEFN
NQGQAQNNKKQDQVNPAQIANKQSNNTSVSSNQQNLNKLNSNEVTNKNSSKNTTNQTPKE
FTTSNSNSSSAQQTPQNKPINLIQLAKQNVQISQQGDQIKQQQLYLQQYQQQLQQKIINN
KKTNLIVLQNPTLLNSLYNISEEPNEQYTDMQSKSNFDFASSINGRSQLLDQTQNNNSNY
KPTQNLLLSNFSLQTQKDLNKKASIEQFPHNLKNQQNTITQPSVSILLENNSTNNAIQSQ
SIVNQNQTVKNISSYGKEIFSDKQKVTQSTQQITNHNGQQKDQKNQNLLDLLTNNISEQK
EQSQTTKDLQKTNQLTQQKAQINQHQTTNHQTQQKSTVTDKIQIISEPIQTKNDIKTQPQ
IASKEKVESQSILISNILKSQEEIKKETESASTDMTTKKQEEQASKTRIQEIIQREKKRE
NSQKKIQQITQPTQSKSKMNFSQTPSMLPQMSTKLSNNNLSVNSTVLNSSNVLPSQTSQS
NKKDKYQKLSKANTANISKNLSYSMLQEQHSVLETSKLDKSVNADGQKQINNYIILKNIG
HGAFGKVKQVFDTNTKKHFAVKIINRDKLMKKKLDRNKSAFSLIEKEIAICKKMAHPNIV
KLYEYIDDQDEAKIYMIMDLLKKGSINSKSYWKTEKGKEYKETEKYNMSEQKLKKYFRDF
LLGLDYLHNFVNVVHRDIKPDNLLIGDEDQLKIADFGVSQMFEGEKDELNNDNGTKCYLA
PEAFTSNGFNGRPLDIWAAGVSLYEIFTGSRPFNGRTLEVLKKSILETEPNYPSNMSPEF
VSMLQKCLNKDPKKRADVQALIVDDWVTDKGQNPLEFPIYEGDFHDIKDDELKNAITKSF
LNKRVNIQAKLKEKIVKTRINIEKKKSFQIEEDVNNNTLNVNKL


>TTHERM_00384880(gene)
ATGGGATGTGGAAGTACAAGATTTTAAGTTTAAGGAAATTAACCTCTTTCATAAAAAAAC
AAGTAATGCAATGATTTAAATAAATATTTTGATGATCTGATAGATTAACATTTATTTATA
TTTCAATATTGTAAAAATAGAAAGCTCAATAAATTTTATGAAACCAAAGAAATCGGAATA
TAGACTTCCTACAATAATTTGTATGATAAATTAGAAAGCGAAAAACCTCCAACTCCTAAA
TAAGTTAGGACAGAGGGAGTCAATATCCATGTAAAACCAATTAATAACCCTGTTATAAGG
AGAAATACTATGAGGCGTAATTACTTAGATATACTTTAAATAAGGCTGCAAAATGAAAAA
ATATTGTATTTAGACAATATAAAAAATGCCTTTTATATAATAAAACAAGTTTGTTAAATT
CAAATAATTTTATTTTGGTATAAAACAGATGAATCTACTAGGGTTTTGAAGAAAAAGAGT
AGCTTTTTCCATTAAAAAGATGTAAAACTTTGCATTATTGAGATATTGTCTTATCATATT
TAATTTGCTTTTGGAAACAAATTATGATTTCTAAAATTAATATATTATTGTAGAATGAAT
AGAACAAATCGAAAGACTCAGATATATTTAGCTTCGATAACAATAATGGAGGGAAAACAG
GATAGCTTGAAAAAGTAAAACTAATTCATGTATTTAAGCAAATTATTTTTAGTATTTAAA
ATAGAAAGCTAAATCAATATCTTATTATTTGATTGCTTTAAATTTTTTGAATAACTTCTT
GAATTATGTTCAGCTTATAAAAATCTATTTTATTGTTATTTGTTTCTAAAGAAAATATTT
TTAATTAGTCAGAGTAGCTACAGGGTAATAAATAGAATAGTAATAATTCATAGGAATTTG
ACTCTCCGTTCGGATAGCAAAGGAATAACGACAGTGAAAATAAAATTGATATTTAGAATT
TAAATAGTAATAACAATAGCATTTAAAATAGTGTAGGAAGGGATCATTTAAACTCACCAT
CCTTAGCTAATTAGACAGCTAATTTTTTTAAAAATGGAGAAAATGATAATTTCAGTAGTA
GGGAGTATAATAATTCATCACCTTAAATATTTTCAAATAATATAATACCTGAAACAGCAA
ATAAAAATATAATTGAGCGTCAAAATAATCGTACGCCTACCTTGAGTAAGCCAAGCTCGT
TGATAAACCCTACATTTAGTAATGACTACATTTTGGTAGGAGGAATAGCAACTGAGTAGA
ATATTAGTGGCTTAGGTAATGGTATAATAGTGAATCATAGCAATTAATATGGTAAGTAAT
TAAGCTAAATCAGTGAAGAAAAAGAAATGAGTTTACTTACTAACCATATAAGAAGGACTA
ATTAAAAAAAAAGTTCGATAAAAGTAGATAATGATTCAAACAATAGCTAATCTGATAATA
ATTTAGTATAAGGCAATGCCACGAGTAGAGGCTCTGCAAATATTACTACGGCAGATTAGA
CTAGCCCTTAGAATTGTTAAGGTTTGAATGGGACAATCATTAATGCTATTGGAAATTACA
ACAACAATGCTTTTAATAATTAAAATAATATCTTGCAAAAAGAAATTACTTGTAATCAAA
ATAATTAAATCAATGCTAATACTAATAAAGCTGCTTGTGCTAAGGAGTAATAAAATGATG
TAGTTTTTAATGAAAATAATACAATTTAAATCTCGACTTAAATAAATAATAAATCAAATA
ATTTGAATAAAGAAGAAAATGATTAAAATGAAGAAAAAATAAATAAAACATAATCTCAAG
ATCCTTCTATGCCTTTATAATAATAGAAATCTAATGGATCTTTTAGGATAAAAAAAAATA
TGAATACAAAAAGTGTTTCTGTGCATACAAGTCCAAATGAAATAATTGAAAAAAGCTACT
AAAAATAAAATAGCTTACATAAAAATGAAATACTCAACTAAAATACCATAAGATAAAACA
ATTTCTATAACAATTAACATGTATCAAGCCACGATTTTGTCCCGATCGAATAGCAGAATA
ATCCTGTGATGCAATCTAGAGATGAGCAACATTCAAATATATTCTTTAATAATACAACTT
CTCCAAAAAAATAAAATACTATAAATAATACACCATAAAGTAATCAAAAGAGTAGTATTA
ATTTAATAGATTATGTAAAGAATCAATAGTTAGCTTAGAGAGAAACATTCAGAAATAATT
AGTAAAGTATATATAATCATTTCAGACAGTTCAAGCAACCGTTAAAGTAAGACTCAGATA
AACTTAATAATATTAATCTTTAAGACGATTACTAAAATCTATAGTCAGCAGGCTTAAAAT
AAACAAGAAAGTTGTCAAGATTAAATCCCAGAATGAGCTAAAATATAACAAAGTTTGTAT
CACCTAAAACAAATCTTATCGAATTTGTTTAATAGATGCAATACAAAAGCTAGAGAAACA
GCTCTGTTTCATTGCAGAGTCCTTTTTTATTTCAAAGTTAATTTTAACCCTAAAACTATT
ATGACCAAAACATGGAAATAGATGGACTTTCTCCTATTAGTTCAAACGTAAATCCTAATT
TTAGAGGTGGATACGATTACGATGTAGAAGATGAAGAAGTAGCAAGACAAATGGAAAATG
ATAAGTCTAATATGAATATTGCTAGCATGACAAACTTTTAAAACTCCAATAATTCTAGCA
GTAAGATTAGTTTTATTATAAAAAAAGTATTTATTCTAATCGTTTATTCTAAATAGGTTA
TGAGGAACAAAGAGGTGCTTACTCTCCTTACTCTAAAGAATAATCTTAAACAATATCTGT
TTTACCTTCTATAATTAATGGGTCAGAATTTTGCGATAACTCTAAAATAGATTTTGATAA
ATATGATATAGAATACATAGATGGATATGATGGTGTGTACAAAGGCTAAAATAATTTGCT
ATCTTCTAAATTACAGCATTCATAAATTTTAAATAGTTAGCTATTCTCATAATAGAATGT
AGTATTGCCAAGCAGTATTGCAAATAGCTAATCAGTTTATTAAAATTCTAAAACTCAACC
AAGCAATAAATAATTACCTTCTTAATCCGGGATCCATAGTTAAGTTATAGGTTCTATGAA
TTCTCTAAAAGTAAACTCTCCTCAACTAACAGGTCTCATTTATTAAAATATTCCAAATTT
ACAAAAAAGATCAGTAAGTGCAGCTCCAAATTAATCTTAAATGTTAATTTCAAATCAACA
ATAAAATGGAAACGCAAATCCTCAATTTAAAAAAGTTTTTAGTGAATTTGACTCTTCTCC
CATATCTTAAAATTAGTTTAGCCATAAATATTCATCAAAAAAAGTATCAAAAAAAGAATC
TATTAGCCCAAAAACAGATGGAAAGTAAATACTAAATTTTACTTAATCTTCATCTACTCA
CAACCAAGCTTAAACTTCTTTAAAAGATTTATAGTAAGGAAAATAACAAATTTAAAATTA
GAACTAAGAAGATTAATAAAATCTAAATAAGAACTAAAATTCTAAATAGATCAATTCAAA
TTATAACTTTGGTCAAATCTCTTCTTCTTAAAATATTGCATAATAGGGTCAGATATAACA
ATAACTATCATTATAATAACAATAATTATAATTGTAAAAACAATAACAATAGTAATAGCA
ATAATTTTAATAATAATTATAATAGTAGTTTACTTATGAAACTAATTAAAAATTGTATAG
TTAAAATTCTAATTTATTGAATCAAATGATATAACAGTCTTAATTGAATAACTAAAATCC
CATTTAGCTAAGAAAGCAGAGCTCTTCATCTCGACGCTCTAACCAAAGTATACACTAACC
TAATAGAGGTATAGAAAATAAAAATAACTAGACAAGTAATACAAATGAAAGCAAATCGAG
TGTAAATCAAAGTAGTGGCAATGGCTTTTATAACTCCTCTGATAAAAAAGGAGTACCTTT
AATTAAATCATTAGAAAATAAGATAAGAAATAGCATAAATAGCAGTCCTAGTAAAAATTC
ATCCAATCACCTTTCACCAACCTATGCTACTGATAAAAAATTTGTCAGAAGTAGTAATAG
AAAAACAACCATGGAGGTCAAAGATATTATTCGAAAGCGCTCTGATTCCAGTTTAAGTCA
GAATTCAAATGATTCTCTTTTAACAAATTAAGAAAATATGCTATAAAAAGAAAAGCCCTA
AGCTACTGCATCATAATTTTAAAAACTGTACAAAGGCAATACAAAAGAAAATGCAGAAAT
TCAACTAAATTCAAATTAAGAATTGCTAACAAATGATCAAGTGGAATTTAATAACTAGGG
ATAAGCTCAGAATAATAAGAAATAAGATTAAGTAAATCCTGCTTAAATCGCAAATAAACA
AAGTAATAATACTTCAGTAAGCAGCAATCAACAAAACTTAAATAAATTAAATAGTAATGA
AGTTACTAATAAAAATAGCTCTAAAAATACTACTAACTAAACTCCAAAAGAATTCACAAC
CTCTAACAGTAATAGCTCTTCTGCTTAACAGACACCCTAAAATAAACCAATTAATCTCAT
TTAACTTGCTAAATAAAATGTCTAAATAAGCTAGTAAGGTGATTAAATCAAGCAACAGTA
GCTATATTTGTAGCAATACCAATAATAGCTATAATAAAAAATAATAAATAACAAAAAAAC
AAACTTAATTGTTTTATAAAATCCAACTTTACTAAATTCTCTGTATAATATATCTGAAGA
ACCTAATGAACAGTATACTGATATGCAAAGTAAATCAAATTTCGATTTTGCATCTTCTAT
AAATGGTCGCTCTCAATTGCTTGATTAAACATAAAATAATAATTCTAATTATAAACCAAC
TTAAAATTTACTTTTAAGCAATTTCTCACTTTAGACCTAAAAAGATTTAAATAAGAAAGC
TAGTATAGAATAATTTCCACATAATTTAAAGAATTAGTAAAACACAATTACTTAGCCTTC
AGTTAGTATTTTACTAGAAAATAACTCAACTAATAATGCAATTTAAAGCTAAAGTATTGT
TAACCAAAACCAGACAGTGAAAAATATATCAAGTTATGGAAAGGAGATTTTTTCTGATAA
ATAGAAAGTAACTTAGAGTACTCAACAAATTACAAATCATAATGGATAACAAAAAGACTA
AAAGAATTAAAATTTATTAGATCTCTTAACAAATAACATAAGTGAGTAAAAAGAGTAGAG
TTAAACAACAAAAGATTTATAAAAAACAAACTAACTAACTTAACAAAAAGCTTAAATAAA
TTAGCATTAAACAACTAATCATTAAACACAATAAAAATCTACAGTCACAGACAAAATTTA
AATTATATCAGAACCAATATAGACAAAAAATGATATAAAAACTTAACCACAAATAGCTTC
AAAAGAAAAAGTTGAGAGCTAGTCAATTCTTATTTCAAATATTCTAAAAAGTTAGGAGGA
AATAAAAAAAGAAACTGAATCAGCCAGTACAGATATGACAACTAAAAAGTAAGAAGAGTA
GGCTTCTAAAACTAGAATTTAAGAAATTATCTAAAGAGAGAAAAAGAGAGAGAATTCACA
GAAGAAAATTTAATAAATCACACAACCAACTTAGTCAAAATCAAAAATGAATTTCTCTTA
AACTCCTTCAATGCTTCCCTAAATGTCAACTAAATTGAGTAATAATAATTTATCTGTAAA
CTCAACAGTTCTTAACAGTTCAAATGTTTTGCCAAGTCAAACATCGTAATCAAATAAAAA
AGATAAGTATCAAAAACTTTCGAAAGCAAATACAGCAAACATTTCTAAAAATTTAAGTTA
TAGCATGCTGTAAGAGTAGCATAGTGTATTGGAGACAAGCAAATTAGATAAATCGGTAAA
TGCTGATGGATAAAAATAAATAAATAACTACATTATTCTCAAAAATATTGGACAGTATAT
TAAAATTATTTTAATTTTATGAATATACATTTATTTTAATATTTTAAAACTACTAGCGGA
GCATTTGGAAAAGTCAAATAAGTATTTGACACTAATACTAAAAAACACTTCGCAGTCAAA
ATCATCAATAGAGACAAGCTAATGAAGAAAAAGTTAGATAGAAACAAGAGTGCATTTAGC
TTGATTGAAAAAGAAATAGCTATCTGTAAAAAAATGGTATTGAAATAAAATAATTTCTTT
TTTGTACTTAAACTAATTAATGATTTTTTAATTAGGCACATCCTAATATAGTTAAGTTGT
ATGAATATATTGATGATCAAGATGAAGCCAAGATATATATGATTATGGACTTATTGAAAA
AAGGTAGTATAAATTCTAAATCTTATTGGAAAACAGAAAAAGGAAAAGAATATAAAGAAA
CGGAAAAATATAATATGTCAGAGTAAAAGCTTAAAAAATACTTTAGAGATTTTTTACTTG
GACTTGATTATTGTAATAAATTAATTTTTCATTTTATCAAGTTTTTTTTTATCACAATGT
ATATTATTGTATAGTGCATAACTTTGTGAATGTTGTTCATAGAGATATCAAGCCAGATAA
TTTATTGATTGGAGACGAGGATTAGCTAAAAATTGCTGATTTTGGAGTATCCTAAATGTT
TGAAGGAGAGAAAGACGAATTAAACAATGATAATGGAACAAAGTGCTATTTAGCTCCAGA
GGCATTTACCTCTAACGGATTTAATGGAAGACCTTTAGATATTTGGGCTGCTGGAGTATC
ATTATATGAAATTTTTACAGGAAGCAGACCATTTAATGGAAGGACGTTGGAAGTTCTTAA
AAAAAGTATTTTAGAAACTGAGTAAATTGATTTTTTTTTATTCAATATTTTTAATGAATG
ATAATAATTAAAGATTATATGTAAATATTATAAATAATTTAAAAATTTAGACCTAACTAT
CCAAGTAACATGTCACCTGAGTTTGTAAGTATGCTTTAAAAATGTCTAAACAAAGATCCA
AAGAAGAGAGCTGATGTTTAAGCCCTAATAGTAATAAAAGTTATTGAAAAAATTGTATTT
ATAAATGATATTTTAAATAGGTAGATGATTGGGTTACTGATAAGGGATAGAATCCATTAG
AATTTCCTATTTACGAAGGAGATTTCCATGATATTAAAGACGACGAATTAAAGAATGCCA
TTACCAAATCTTTCTTAAACAAAAGGGTAAACATTCAAGCCAAGTTAAAAGAGAAAATTG
TAAAAACTAGAATAAATATAGAAAAGAAGAAAAGCTTTTAAATAGAAGAAGATGTTAATA
ATAATACTCTTAATGTAAATAAGCTATGA